Protein Info for ABIE51_RS06500 in Lysobacter sp. OAE881

Annotation: peptidoglycan DD-metalloendopeptidase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 262 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details PF01476: LysM" amino acids 54 to 94 (41 residues), 57.9 bits, see alignment 8e-20 PF01551: Peptidase_M23" amino acids 162 to 255 (94 residues), 104.6 bits, see alignment E=2.7e-34

Best Hits

Swiss-Prot: 43% identical to YGER_ECOLI: Uncharacterized lipoprotein YgeR (ygeR) from Escherichia coli (strain K12)

KEGG orthology group: K06194, lipoprotein NlpD (inferred from 60% identity to xom:XOO_2805)

MetaCyc: 43% identical to amidase activator (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Lipoprotein NlpD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (262 amino acids)

>ABIE51_RS06500 peptidoglycan DD-metalloendopeptidase family protein (Lysobacter sp. OAE881)
MTGTSRNVAVRSLAAASLVAFAALLGGCWTTKVYREPGASSEAPSKPRPGVTTTVRRGDT
LFSIASRNGVRQQDLAAWNGIAAPYTIYPGQKLRLYPAGKGGSTAATRPSTTTTTTTKPA
ATTPAAPAPAPKPAAPAASDIRWRWPADGELIGRYVAGEPTKQGVDIAGASGAPVRAAAD
GVVVYSGSGLVGYGELIIIKHNEQWLSAYGHNRNRLVNEGQLVRSGQQIAEMGRSGAPRE
MLHFEVRYNGKPVDPLIYLPKR