Protein Info for ABIE51_RS05545 in Lysobacter sp. OAE881

Annotation: RNA polymerase sigma factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02937: RNA polymerase sigma factor, sigma-70 family
  • amino acids 7 to 167 (161 residues), 79.4 bits, E=1.2e-26
• PF07638: Sigma70_ECF
  • amino acids 36 to 168 (133 residues), 22 bits, E=2.1e-08
• PF08281: Sigma70_r4_2
  • amino acids 112 to 163 (52 residues), 65.1 bits, E=5.3e-22
• PF04545: Sigma70_r4
  • amino acids 116 to 164 (49 residues), 39.4 bits, E=5.2e-14

Best Hits

KEGG orthology group: K03088, RNA polymerase sigma-70 factor, ECF subfamily (inferred from 73% identity to psu:Psesu_2373)

Predicted SEED Role

"RNA polymerase sigma-54 factor RpoN" in subsystem Flagellar motility or Flagellum or Transcription initiation, bacterial sigma factors

Protein Sequence (171 amino acids)

>ABIE51_RS05545 RNA polymerase sigma factor (Lysobacter sp. OAE881)
MRLPASLEEFLAGIGTRAFRFAELGLRNRDDALDAVQDAMMKMLAYRERPAAEWTPLFWS
ILRSRIIDVQRRRTFRLRWLMPAPEREESAIDWADDAPDPSRAHEGREAYGKLADALATL
PARQREAFTLRVLEELDVATTARAMGCSEGAVKTHLSRAREALQRQLEDWR