Protein Info for ABIE51_RS04905 in Lysobacter sp. OAE881

Annotation: lactoylglutathione lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 175 TIGR00068: lactoylglutathione lyase" amino acids 13 to 171 (159 residues), 163.7 bits, see alignment E=1e-52 PF00903: Glyoxalase" amino acids 25 to 168 (144 residues), 106 bits, see alignment E=2.6e-34 PF13669: Glyoxalase_4" amino acids 26 to 151 (126 residues), 37 bits, see alignment E=5.8e-13 PF18029: Glyoxalase_6" amino acids 29 to 164 (136 residues), 25.3 bits, see alignment E=3.1e-09

Best Hits

Swiss-Prot: 74% identical to LGUL_PSEPU: Lactoylglutathione lyase (gloA) from Pseudomonas putida

KEGG orthology group: K01759, lactoylglutathione lyase [EC: 4.4.1.5] (inferred from 75% identity to pfo:Pfl01_2923)

MetaCyc: 74% identical to glyoxalase I monomer (Pseudomonas putida)
Lactoylglutathione lyase. [EC: 4.4.1.5]

Predicted SEED Role

"Lactoylglutathione lyase (EC 4.4.1.5)" in subsystem Glutathione: Non-redox reactions or Methylglyoxal Metabolism (EC 4.4.1.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.4.1.5

Use Curated BLAST to search for 4.4.1.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (175 amino acids)

>ABIE51_RS04905 lactoylglutathione lyase (Lysobacter sp. OAE881)
MSLQEQLNATPGVAARDAATHGFVFNHTMLRVKDIAKSLDFYTRVLGFTLVRRRDFDEAK
FSLYFLVLVDDPSQIPAEEPARGQWLLSQRGVLELTHNHGTESDAEFRYHDGNAEPRGFG
HICVSVPDVEAACARFEQLGVAFQKRLTDGRMKDIAFIKDPDGYWVEILQPTARV