Protein Info for ABIE51_RS04395 in Lysobacter sp. OAE881

Annotation: electron transfer flavoprotein-ubiquinone oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 540 PF01946: Thi4" amino acids 12 to 59 (48 residues), 28.1 bits, see alignment 3.4e-10 PF13450: NAD_binding_8" amino acids 21 to 61 (41 residues), 26.9 bits, see alignment 1.4e-09 PF21162: ETFQO_UQ-bd" amino acids 212 to 305 (94 residues), 119.9 bits, see alignment E=1.7e-38 PF05187: ETF_QO" amino acids 441 to 538 (98 residues), 147.1 bits, see alignment E=5.2e-47

Best Hits

KEGG orthology group: K00311, electron-transferring-flavoprotein dehydrogenase [EC: 1.5.5.1] (inferred from 82% identity to psu:Psesu_2442)

Predicted SEED Role

"Electron transfer flavoprotein-ubiquinone oxidoreductase (EC 1.5.5.1)" in subsystem Acetyl-CoA fermentation to Butyrate or Anaerobic respiratory reductases (EC 1.5.5.1)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.5.5.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (540 amino acids)

>ABIE51_RS04395 electron transfer flavoprotein-ubiquinone oxidoreductase (Lysobacter sp. OAE881)
MNQPDPNAVERDVMEYDVVTVGAGPAGLSFAIRLKQLNPELSVCVIEKASTIGAHILSGA
VIEPEPLDALLPNWRDNPPPICVPAKHDEFWLLTHKGHRRLPIPPGMHNEGNFIVSLGAM
CAWLAPQAEALGVEIYPGFAAAETLHDESGAVVGVRIGDMGIAKDGSHKPGYTPGIDIRA
KVTVLAEGARGHLTKRLIKQFKLDADSDPQGYSIGIKELWQVPEDRVTPGKIVHSFGWPA
DNEVYGGGFLYHLDKGRIALGYVSGLDYKDPEYKPWEAFQQWKNHPLFEPLLEGGTILSA
GARAIVTGGYQSLPKLEMPGALLIGDTAGLLNVPKIKGTHQAIRSGMLAAEHLVASQLSP
QGFDARLRDSNIMAELKKVRNFKPGFKRGLWFGILNSAWETVTGGLSPWTLKNKADWCSL
DKVGEHESPKRDYIERKLAPRDRLQGVYYAATEHDEDQPVHLKVRDTSICVTRCAEEYDN
PCTRFCPAAVYEIVQDEAGKRLQINAANCVHCKTCDIKDPYEIIDWVTPEGGSGPNYQNL