Protein Info for ABIE51_RS02890 in Lysobacter sp. OAE881

Annotation: bifunctional 4-hydroxy-2-oxoglutarate aldolase/2-dehydro-3-deoxy-phosphogluconate aldolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01182: 2-dehydro-3-deoxyphosphogluconate aldolase/4-hydroxy-2-oxoglutarate aldolase
  • amino acids 8 to 207 (200 residues), 231.4 bits, E=3.3e-73
• PF01081: Aldolase
  • amino acids 10 to 201 (192 residues), 204.7 bits, E=5.1e-65

Best Hits

Swiss-Prot: 47% identical to ALKH_ECOLI: KHG/KDPG aldolase (eda) from Escherichia coli (strain K12)

KEGG orthology group: K01625, 2-dehydro-3-deoxyphosphogluconate aldolase / 4-hydroxy-2-oxoglutarate aldolase [EC: 4.1.2.14 4.1.3.16] (inferred from 54% identity to reu:Reut_B4024)

MetaCyc: 47% identical to KHG/KDPG aldolase (Escherichia coli K-12 substr. MG1655)
RXN-13990 [EC: 4.1.3.42]; 2-dehydro-3-deoxy-phosphogluconate aldolase. [EC: 4.1.3.42, 4.1.2.14, 4.1.2.55]; Malate dehydrogenase (oxaloacetate-decarboxylating). [EC: 4.1.3.42, 4.1.2.14, 4.1.2.55, 1.1.1.38, 1.1.1.40, 1.1.1.83, 4.1.1.112]

Predicted SEED Role

No annotation

MetaCyc Pathways

• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (22/26 steps found)
• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (19/22 steps found)
• superpathway of glycolysis and the Entner-Doudoroff pathway (15/17 steps found)
• anaerobic energy metabolism (invertebrates, cytosol) (7/7 steps found)
• superpathway of glyoxylate cycle and fatty acid degradation (12/14 steps found)
• TCA cycle III (animals) (9/10 steps found)
• glyoxylate cycle (6/6 steps found)
• gluconeogenesis I (11/13 steps found)
• Entner-Doudoroff pathway I (8/9 steps found)
• TCA cycle II (plants and fungi) (8/9 steps found)
• TCA cycle V (2-oxoglutarate synthase) (8/9 steps found)
• superpathway of glyoxylate bypass and TCA (10/12 steps found)
• D-galactonate degradation (3/3 steps found)
• TCA cycle I (prokaryotic) (8/10 steps found)
• superpathway of anaerobic energy metabolism (invertebrates) (13/17 steps found)
• TCA cycle VIII (Chlamydia) (5/6 steps found)
• Entner-Doudoroff shunt (2/2 steps found)
• malate/L-aspartate shuttle pathway (2/2 steps found)
• Entner-Doudoroff pathway III (semi-phosphorylative) (7/9 steps found)
• TCA cycle IV (2-oxoglutarate decarboxylase) (7/9 steps found)
• 4-deoxy-L-threo-hex-4-enopyranuronate degradation (4/5 steps found)
• gluconeogenesis III (9/12 steps found)
• D-fructuronate degradation (3/4 steps found)
• superpathway of β-D-glucuronosides degradation (5/7 steps found)
• mixed acid fermentation (11/16 steps found)
• trans-4-hydroxy-L-proline degradation I (3/5 steps found)
• D-galacturonate degradation I (3/5 steps found)
• chitin deacetylation (2/4 steps found)
• C4 photosynthetic carbon assimilation cycle, NAD-ME type (7/11 steps found)
• 3,6-anhydro-α-L-galactopyranose degradation (4/7 steps found)
• C4 photosynthetic carbon assimilation cycle, NADP-ME type (4/7 steps found)
• D-glucosaminate degradation (1/3 steps found)
• anaerobic energy metabolism (invertebrates, mitochondrial) (6/10 steps found)
• superpathway of hexuronide and hexuronate degradation (6/10 steps found)
• gentisate degradation II (1/4 steps found)
• reductive TCA cycle I (6/11 steps found)
• L-glucose degradation (3/7 steps found)
• incomplete reductive TCA cycle (3/7 steps found)
• pyruvate fermentation to propanoate I (3/7 steps found)
• C4 photosynthetic carbon assimilation cycle, PEPCK type (8/14 steps found)
• methylgallate degradation (2/6 steps found)
• methylaspartate cycle (11/19 steps found)
• protocatechuate degradation I (meta-cleavage pathway) (3/8 steps found)
• formaldehyde assimilation I (serine pathway) (6/13 steps found)
• reductive TCA cycle II (5/12 steps found)
• superpathway of vanillin and vanillate degradation (3/10 steps found)
• L-glutamate degradation VIII (to propanoate) (3/11 steps found)
• (S)-lactate fermentation to propanoate, acetate and hydrogen (4/13 steps found)
• syringate degradation (3/12 steps found)
• superpathway of microbial D-galacturonate and D-glucuronate degradation (11/31 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (20/56 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of terpenoids and steroids
• Butanoate metabolism
• Carbon fixation in photosynthetic organisms
• Glyoxylate and dicarboxylate metabolism
• Pentose and glucuronate interconversions
• Pentose phosphate pathway
• Pyruvate metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.40, 4.1.2.14, 4.1.3.16

Use Curated BLAST to search for 1.1.1.38 or 1.1.1.40 or 1.1.1.83 or 4.1.1.112 or 4.1.2.14 or 4.1.2.55 or 4.1.3.16 or 4.1.3.42

Protein Sequence (211 amino acids)

>ABIE51_RS02890 bifunctional 4-hydroxy-2-oxoglutarate aldolase/2-dehydro-3-deoxy-phosphogluconate aldolase (Lysobacter sp. OAE881)
MSAVDAQALLHGHRVMPVYTPASVDEARAVARALQAGGIGAIEVTLRTPAAMGAVAALVR
EMPDMRIGAGTVLEVEQLRRLKDVGAVFAVSPGSTPELLAAAVELDIAYLPGVATGSEVM
AALAAGHRLLKVFPAEPINALELIDAWRGPFAQARFCPTGGIDAARAREYLRRSNVACLG
GSWLTPADALREGDWARVEALAREAVALAAE