Protein Info for ABIE51_RS01815 in Lysobacter sp. OAE881

Annotation: shikimate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 280 TIGR00507: shikimate dehydrogenase" amino acids 4 to 271 (268 residues), 236.9 bits, see alignment E=1.2e-74 PF08501: Shikimate_dh_N" amino acids 7 to 89 (83 residues), 90.1 bits, see alignment E=1.3e-29 PF01488: Shikimate_DH" amino acids 112 to 194 (83 residues), 44.4 bits, see alignment E=2.7e-15 PF18317: SDH_C" amino acids 240 to 270 (31 residues), 38 bits, see alignment 1.6e-13

Best Hits

Swiss-Prot: 66% identical to AROE_STRMK: Shikimate dehydrogenase (NADP(+)) (aroE) from Stenotrophomonas maltophilia (strain K279a)

KEGG orthology group: K00014, shikimate dehydrogenase [EC: 1.1.1.25] (inferred from 66% identity to sml:Smlt4495)

MetaCyc: 44% identical to shikimate dehydrogenase (Escherichia coli K-12 substr. MG1655)
Shikimate dehydrogenase. [EC: 1.1.1.25]

Predicted SEED Role

"Shikimate 5-dehydrogenase I alpha (EC 1.1.1.25)" in subsystem Chorismate Synthesis or Common Pathway For Synthesis of Aromatic Compounds (DAHP synthase to chorismate) (EC 1.1.1.25)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.25

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (280 amino acids)

>ABIE51_RS01815 shikimate dehydrogenase (Lysobacter sp. OAE881)
MVKRFAVIGHPVAHSLSPRIHAAFGRQLGIALDYAAMDAPPELFDAIVAEFAAEGGLGAN
VTLPHKNRAVSVCTTLSERARRAGAVNTLVRTATGWEGDNTDGVGLVRDLTERQGLDLRS
RRTLLIGAGGAARGVAPALLDAGIGDLYIVNRTPERADALADALAMPGRVHPRYLRDIDT
LGTFDLIVNATSAARADGLPSLPMALANPRTAAVDLSYGEVAIPFLAWARAAGVHDGIDG
LGMLVEQAAESFLRWHGVRPETDEVYETLREHRAELVTAD