Protein Info for ABIE51_RS01740 in Lysobacter sp. OAE881

Annotation: 16S rRNA (guanine(527)-N(7))-methyltransferase RsmG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02527: GidB
  • amino acids 33 to 213 (181 residues), 174.9 bits, E=5.8e-56
• TIGR00138: 16S rRNA (guanine(527)-N(7))-methyltransferase RsmG
  • amino acids 34 to 216 (183 residues), 172.6 bits, E=3.3e-55

Best Hits

Swiss-Prot: 69% identical to RSMG_XANC5: Ribosomal RNA small subunit methyltransferase G (rsmG) from Xanthomonas campestris pv. vesicatoria (strain 85-10)

KEGG orthology group: K03501, ribosomal RNA small subunit methyltransferase G [EC: 2.1.1.170] (inferred from 71% identity to psu:Psesu_2850)

MetaCyc: 46% identical to 16S rRNA m7G527 methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-11578 [EC: 2.1.1.170]

Predicted SEED Role

"rRNA small subunit 7-methylguanosine (m7G) methyltransferase GidB"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.170

Protein Sequence (219 amino acids)

>ABIE51_RS01740 16S rRNA (guanine(527)-N(7))-methyltransferase RsmG (Lysobacter sp. OAE881)
MNTPAPFDAALRRTLDDGLLALGLDPAAVSAPLLDYLALLVRWNKTYNLTAVRDPHEMVV
KHLLDSLAMHPYVDDLAARGGSLADLGTGPGLPGIPLSIVKPGLKVTLVESNGKKARFMR
EAIRQLGLRDARVAESRIEAVDEPGAYDAITARALATLPLILELGGHLLKPDGRLLAMKG
VHPADEIAALPAGWTVEASHPMRVPGLDAERHMVVIARR