Protein Info for ABIE51_RS01405 in Lysobacter sp. OAE881

Annotation: YbhN family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 319 signal peptide" amino acids 1 to 34 (34 residues), see Phobius details transmembrane" amino acids 43 to 65 (23 residues), see Phobius details amino acids 85 to 106 (22 residues), see Phobius details amino acids 125 to 146 (22 residues), see Phobius details amino acids 166 to 184 (19 residues), see Phobius details amino acids 204 to 226 (23 residues), see Phobius details amino acids 236 to 256 (21 residues), see Phobius details amino acids 278 to 302 (25 residues), see Phobius details PF03706: LPG_synthase_TM" amino acids 20 to 294 (275 residues), 43.8 bits, see alignment E=1.3e-15

Best Hits

Swiss-Prot: 43% identical to YBHN_ECOLI: Inner membrane protein YbhN (ybhN) from Escherichia coli (strain K12)

KEGG orthology group: K07027, (no description) (inferred from 48% identity to avn:Avin_24810)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (319 amino acids)

>ABIE51_RS01405 YbhN family protein (Lysobacter sp. OAE881)
MTVSRQRWRKIRRVAFYVFLALVAVLLVRYARSVDWAQVGATLAGYGPGTLAIAIGLTVA
SYLLYSAYDLAGRRYARHDLPTPKVMGIAMLAYAFSLNVGALFGGAGFRYRIYSQAGLGL
GTISRIVAFAIGTNWMGYLLLAGALFASGRVRPPPNWPVTGERLPWLGAAMLAAVAVYLV
ASHVTHGRVYHVRGHHFRLPSLPLALLQLALAATNWALMAALVFVLMPDGVAYADVLGAL
LVAAVASAIAHIPAGIGVQEAVFIALLGHQVPQPQMLAALLAHRACYYLGPLIVAVAGYA
LFETRRRKRPHPTVESGSP