Protein Info for ABIE51_RS01165 in Lysobacter sp. OAE881

Annotation: multidrug resistance efflux transporter family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 330 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 37 to 56 (20 residues), see Phobius details amino acids 77 to 96 (20 residues), see Phobius details amino acids 102 to 123 (22 residues), see Phobius details amino acids 130 to 150 (21 residues), see Phobius details amino acids 162 to 178 (17 residues), see Phobius details amino acids 199 to 220 (22 residues), see Phobius details amino acids 228 to 248 (21 residues), see Phobius details amino acids 260 to 284 (25 residues), see Phobius details amino acids 290 to 311 (22 residues), see Phobius details PF13536: EmrE" amino acids 45 to 305 (261 residues), 240.7 bits, see alignment E=2e-75

Best Hits

KEGG orthology group: None (inferred from 41% identity to bao:BAMF_1315)

Predicted SEED Role

"membrane protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (330 amino acids)

>ABIE51_RS01165 multidrug resistance efflux transporter family protein (Lysobacter sp. OAE881)
MKARSTALAAVAIALASAFFFTCTYVLNRAAATEGGYWAWTACLRYLITLPLLLPVMPWQ
GGVAPVWRAIRAHPGPWLLWSGIGFVLFYLCLSYAASSGPSWLIAGTFQLTVIAGMLCAP
FLYRDERARVPMPALATGLLVVAGVLLLQFGHGGGSLDRDGWIALVLVAISAFAYPLGNR
GLLLHLERSGIELNATQRVFGMTLASQPMWWAVAAITLAQVGPPPLGQVSFAAGVALGAG
VIATVLFFQATGMVRSNPTALAAAEAMQAAEILFATLIGVLWLGEAWPQGRALAGAVLVV
IGIVVFSIVAARASAGDARAVDEASGDRGA