Protein Info for ABIE51_RS00265 in Lysobacter sp. OAE881

Annotation: 3-oxoacyl-ACP synthase III

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF08545: ACP_syn_III
  • amino acids 117 to 196 (80 residues), 35 bits, E=1.6e-12
• PF08541: ACP_syn_III_C
  • amino acids 254 to 336 (83 residues), 64.7 bits, E=1.1e-21

Best Hits

Swiss-Prot: 75% identical to OLEA_XANCP: Acyl-CoA:acyl-CoA alkyltransferase (oleA) from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)

KEGG orthology group: K00648, 3-oxoacyl-[acyl-carrier-protein] synthase III [EC: 2.3.1.180] (inferred from 76% identity to psu:Psesu_0121)

MetaCyc: 75% identical to acyl-CoA:acyl-CoA alkyltransferase monomer (Xanthomonas campestris)
RXN-18555 [EC: 2.3.3.20]

Predicted SEED Role

"3-oxoacyl-[ACP] synthase III in alkane synthesis cluster"

MetaCyc Pathways

• superpathway of fatty acids biosynthesis (E. coli) (48/53 steps found)
• superpathway of fatty acid biosynthesis II (plant) (38/43 steps found)
• superpathway of fatty acid biosynthesis I (E. coli) (14/16 steps found)
• fatty acid biosynthesis initiation (type II) (3/3 steps found)
• superpathway of fatty acid biosynthesis initiation (4/5 steps found)
• cis-alkene biosynthesis (3/4 steps found)
• streptorubin B biosynthesis (20/34 steps found)

KEGG Metabolic Maps

• Fatty acid biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.180

Use Curated BLAST to search for 2.3.1.180 or 2.3.3.20

Protein Sequence (340 amino acids)

>ABIE51_RS00265 3-oxoacyl-ACP synthase III (Lysobacter sp. OAE881)
MLFQHVAIAGLAHIDAPRRLTSDEIHARLKPTLDRLGIKYNVLEEVAGVRERRLWDGEVK
ASDAATLAGVKALADAGIDADRVGLLVNTSVSRDYLEPSTASIVSGNLRLPDTCQNFDVA
NACLAFLNGMDIASRMIERGEIDYALVVNGETAELAYEKTLDRLSRDDVTEEQFRDEMAT
LTLGSGAAAMVLARSELAPGAPRYRGSVTRSATEWNQLCRGDLVHDRMIADGRMLMIEGL
KLGQKTFAAARAALGWVVEELDEFVIHQVSKAHTKAFLKAFRIDPKKVLTIFGEHGNIGP
ASVPIVLSKLREGGRVKKGTRIALLGIGSGLNCSMAEVVW