Protein Info for ABIE51_RS00235 in Lysobacter sp. OAE881

Annotation: 2-alkyl-3-oxoalkanoate reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 332 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details PF04321: RmlD_sub_bind" amino acids 1 to 239 (239 residues), 52.3 bits, see alignment E=1.9e-17 PF02719: Polysacc_synt_2" amino acids 3 to 110 (108 residues), 26.5 bits, see alignment E=1.4e-09 PF05368: NmrA" amino acids 3 to 115 (113 residues), 24.9 bits, see alignment E=5.2e-09 PF01370: Epimerase" amino acids 3 to 219 (217 residues), 130.8 bits, see alignment E=2.4e-41 PF16363: GDP_Man_Dehyd" amino acids 4 to 244 (241 residues), 48.3 bits, see alignment E=4.2e-16 PF01073: 3Beta_HSD" amino acids 4 to 254 (251 residues), 153.2 bits, see alignment E=3.1e-48 PF13460: NAD_binding_10" amino acids 7 to 152 (146 residues), 54.8 bits, see alignment E=4.7e-18 PF07993: NAD_binding_4" amino acids 58 to 209 (152 residues), 46.7 bits, see alignment E=9.4e-16

Best Hits

Swiss-Prot: 72% identical to OLED_STRMK: 2-alkyl-3-oxoalkanoate reductase (oleD) from Stenotrophomonas maltophilia (strain K279a)

KEGG orthology group: None (inferred from 72% identity to sml:Smlt0209)

MetaCyc: 72% identical to 2-alkyl-3-oxo-fatty acid reductase monomer (Xanthomonas campestris)
RXN-18556 [EC: 1.1.1.412]

Predicted SEED Role

"NAD(P)H steroid dehydrogenase-like protein in alkane synthesis cluster"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.412

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (332 amino acids)

>ABIE51_RS00235 2-alkyl-3-oxoalkanoate reductase (Lysobacter sp. OAE881)
MKILVTGGGGFLGQVLCRGLRDRGHEVVSFNRGRYDALDRLGVTQVQGDLAQRDAVIAAA
AGCEAIFHNAAKAGAWGSYESYHLANVVGTQNVIDACRAQGIGRLVYTSTPSVTHRKTHP
VEGGTAETVPYGDDLKAPYAATKQIAEKLVIAANDAALATVSLRPRLIWGVGDNQLLPRL
VERAKAGRLRIVGDGNNRIDTTYVDNAAQAHFDAFEHLAPGAACAGRAYFISNGEPRTVR
EILNGLLDAAGAPQVDKTIPFGVAYAAGVLCEGLWHALPLKGEPPMTRFLAEQLSTTHWY
DMTPARRDFGYVPSVSIHEGLTRLKVACMGRA