Protein Info for ABIE51_RS00065 in Lysobacter sp. OAE881

Annotation: orotate phosphoribosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 221 TIGR00336: orotate phosphoribosyltransferase" amino acids 12 to 191 (180 residues), 188.8 bits, see alignment E=3.4e-60 PF00156: Pribosyltran" amino acids 54 to 163 (110 residues), 47.1 bits, see alignment E=8.2e-17

Best Hits

Swiss-Prot: 76% identical to PYRE_XANCB: Orotate phosphoribosyltransferase (pyrE) from Xanthomonas campestris pv. campestris (strain B100)

KEGG orthology group: K00762, orotate phosphoribosyltransferase [EC: 2.4.2.10] (inferred from 77% identity to psu:Psesu_0159)

MetaCyc: 46% identical to orotate phosphoribosyltransferase (Saccharomyces cerevisiae S288C)
Orotate phosphoribosyltransferase. [EC: 2.4.2.10]

Predicted SEED Role

"Orotate phosphoribosyltransferase (EC 2.4.2.10)" in subsystem De Novo Pyrimidine Synthesis (EC 2.4.2.10)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (221 amino acids)

>ABIE51_RS00065 orotate phosphoribosyltransferase (Lysobacter sp. OAE881)
MTQDHRARFLDLALRADALRFGDFTLKSGRQSPYFFNAGRFDSGAALAGLAACYADAIDA
HGVGFDLLFGPAYKGIPLATALACEYARRGRDLPVAFNRKEAKTHGEGGNLIGAPLQGRR
VLIVDDVITAGTAIREALGLIRDAGGETAGIVIALDRQEAIDPAKTRRSAAQSVAADHGL
PVIAVATLSDLLDFAGGNAELAAQRGRLLAYRQAYGSDSAG