Protein Info for ABCV34_RS14635 in Castellaniella sp019104865 MT123

Annotation: Nudix family hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00293: NUDIX
  • amino acids 7 to 115 (109 residues), 77.6 bits, E=1.4e-25
• PF14815: NUDIX_4
  • amino acids 10 to 111 (102 residues), 62.7 bits, E=4.1e-21
• PF02581: TMP-TENI
  • amino acids 158 to 324 (167 residues), 112.5 bits, E=2.3e-36

Predicted SEED Role

"Mutator mutT protein (7,8-dihydro-8-oxoguanine-triphosphatase) (EC 3.6.1.-) / Thiamin-phosphate pyrophosphorylase-like protein" in subsystem Nudix proteins (nucleoside triphosphate hydrolases) (EC 3.6.1.-)

KEGG Metabolic Maps

• Folate biosynthesis
• Lipopolysaccharide biosynthesis
• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.-

Use Curated BLAST to search for 3.6.1.-

Protein Sequence (332 amino acids)

>ABCV34_RS14635 Nudix family hydrolase (Castellaniella sp019104865 MT123)
MSKPYIRVAAGLILDARGRLLLGQRPDGKAWPGWWEFPGGKIEAGETVEQALVRELDEEL
GIRATRVYPWVVHVHEYPKSIVELAFCQVTAWEGEPHGRENQALDWVDPWDIRLDESEHP
IAPGGGSLLPAAAPPLRWLRLPMQYRVSHIRHADGLAGWLAQLRQELLQGLRMVQFREPA
WAGDTDSLHDAFQATLALCRQHGARCFINSCHPHGWWSHADGVQLRAADAARILQQDTRP
PGWLGVSAHDAQDIECARQLQADFVVLGHVHPTDSHPGSPALGWARFRELATAAGRPVFA
IGGQSIDTLDAARLHGAHGIAAMRGQLVGGSE