Protein Info for ABCV34_RS13975 in Castellaniella sp019104865 MT123
Annotation: TRAP transporter small permease
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
KEGG orthology group: K11689, C4-dicarboxylate transporter, DctQ subunit (inferred from 80% identity to bpt:Bpet4767)Predicted SEED Role
"TRAP-type transport system, small permease component, predicted N-acetylneuraminate transporter" in subsystem Sialic Acid Metabolism
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (187 amino acids)
>ABCV34_RS13975 TRAP transporter small permease (Castellaniella sp019104865 MT123) MKLLDRLEECLIAFLMGAATLVIFVAVLHRYAAGVNIPYLQDWLLSLNTSWAQELCIYMF VWMAKFGAAYGVRTGIHVGVDVMVNRLQPASRKIFIVTGLLAGALFTGVIGSLGVKFVWA LAQTDQISPDLELPRWIAFLCVPLGSYLMCFRFLQVCAQFLQSGNVPKHDHSHVEGIEPQ PALGTLS