Protein Info for ABCV34_RS12770 in Castellaniella sp019104865 MT123

Annotation: DNA-binding transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 106 PF13560: HTH_31" amino acids 50 to 88 (39 residues), 27.1 bits, see alignment E=4.1e-10 PF01381: HTH_3" amino acids 51 to 95 (45 residues), 39.1 bits, see alignment E=6.2e-14

Best Hits

KEGG orthology group: K07726, putative transcriptional regulator (inferred from 76% identity to dak:DaAHT2_2603)

Predicted SEED Role

"helix-turn-helix domain protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (106 amino acids)

>ABCV34_RS12770 DNA-binding transcriptional regulator (Castellaniella sp019104865 MT123)
MATIKRKSRILAEMHETARDLYEVGLISKRRMHEFDALCHIDVHEIPPQRIKQLRQREHL
SQAVFAAVLNISVSTVQKWEIGDKKPSGPSLKLLSLIERKGLEAVL