Protein Info for ABCV34_RS12285 in Castellaniella sp019104865 MT123

Annotation: LacI family DNA-binding transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 354 PF00356: LacI" amino acids 28 to 73 (46 residues), 47.6 bits, see alignment 2.3e-16 PF00532: Peripla_BP_1" amino acids 86 to 337 (252 residues), 93.5 bits, see alignment E=3.3e-30 PF13407: Peripla_BP_4" amino acids 87 to 308 (222 residues), 51.7 bits, see alignment E=1.9e-17 PF13377: Peripla_BP_3" amino acids 193 to 354 (162 residues), 109.7 bits, see alignment E=3.4e-35

Best Hits

KEGG orthology group: K06145, LacI family transcriptional regulator, gluconate utilization system Gnt-I transcriptional repressor (inferred from 61% identity to pna:Pnap_0047)

Predicted SEED Role

"Gluconate utilization system Gnt-I transcriptional repressor" in subsystem D-gluconate and ketogluconates metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (354 amino acids)

>ABCV34_RS12285 LacI family DNA-binding transcriptional regulator (Castellaniella sp019104865 MT123)
MKHDATSRDGSRRDRGTRARSRATGRVTLADVAALAGVSPITASRVVAGKTTVRPELADR
VQDAVARLGYRPDPSARALASAKSGHIVVLIPLLSNTLFTELLEAIQDVMWDAGYPIFVG
ITQYQPSREAALLENYLSHRPAGLILTGFDRSDVVRRLIADSRTPCVHVMELSDEPGVHC
VGFSQVDAAETVARHLLDRGRRRIAFVGAQLDPRTLERADGFRRALSLAGRYDPRLEVLD
ARPSSAALGAEAFRRLLTAHPDVDAMFFCNDDLAHGALLEALRLGIPIPDRVSVVGFNDL
PGNEQMLPPLTSLRTPRREVGDAAAKMLLRLIRDETVPTPVIDLGFALKIRESS