Protein Info for ABCV34_RS10670 in Castellaniella sp019104865 MT123

Annotation: 50S ribosomal protein L11 methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 304 PF06325: PrmA" amino acids 3 to 303 (301 residues), 288.2 bits, see alignment E=1.6e-89 TIGR00406: ribosomal protein L11 methyltransferase" amino acids 3 to 297 (295 residues), 202.8 bits, see alignment E=4e-64 PF01135: PCMT" amino acids 154 to 221 (68 residues), 21.3 bits, see alignment E=4.1e-08 PF05175: MTS" amino acids 158 to 246 (89 residues), 33 bits, see alignment E=8.9e-12

Best Hits

Swiss-Prot: 69% identical to PRMA_BORBR: Ribosomal protein L11 methyltransferase (prmA) from Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)

KEGG orthology group: K02687, ribosomal protein L11 methyltransferase [EC: 2.1.1.-] (inferred from 71% identity to axy:AXYL_00626)

Predicted SEED Role

"Ribosomal protein L11 methyltransferase (EC 2.1.1.-)" in subsystem Heat shock dnaK gene cluster extended or Ribosome biogenesis bacterial (EC 2.1.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (304 amino acids)

>ABCV34_RS10670 50S ribosomal protein L11 methyltransferase (Castellaniella sp019104865 MT123)
MRELVLSCTEDQAEAWSDALLEAGALSVSVEDADGDTDREQALFGEPGTEPETLAWRNNR
LVALLADGDDPAHLLAALDGLAGPSPATGDWALREVPDADWVRLTQSQFGPIAVGDRIWI
IPSWHREDTDLPAAGRQDGIVRIELDPGLAFGTGSHPTTHLCLEWLAANLTDGQTVLDYG
CGSGILAIAARLLGAGPTRGVDIDEQAVLATTQNAAVNQVQVQACLPDDLPPGTSQVVVA
NILSNPLKVLAPMLSGRVAAGGSLVLSGVLERQAGEVAQAYAPWLPLTVWAARDGWVCLA
GRKG