Protein Info for ABCV34_RS10115 in Castellaniella sp019104865 MT123

Annotation: phosphatidylglycerophosphatase A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 176 transmembrane" amino acids 34 to 59 (26 residues), see Phobius details amino acids 66 to 84 (19 residues), see Phobius details amino acids 104 to 129 (26 residues), see Phobius details amino acids 149 to 173 (25 residues), see Phobius details PF04608: PgpA" amino acids 30 to 169 (140 residues), 121.4 bits, see alignment E=1.5e-39

Best Hits

Swiss-Prot: 38% identical to PGPA_ECOLI: Phosphatidylglycerophosphatase A (pgpA) from Escherichia coli (strain K12)

KEGG orthology group: K01095, phosphatidylglycerophosphatase A [EC: 3.1.3.27] (inferred from 57% identity to put:PT7_3635)

MetaCyc: 38% identical to phosphatidylglycerophosphatase A (Escherichia coli K-12 substr. MG1655)
Phosphatidylglycerophosphatase. [EC: 3.1.3.27]

Predicted SEED Role

"Phosphatidylglycerophosphatase A (EC 3.1.3.27)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 3.1.3.27)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.3.27

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (176 amino acids)

>ABCV34_RS10115 phosphatidylglycerophosphatase A (Castellaniella sp019104865 MT123)
MASGRAPRDSAPPNPERPSAAWVFARPERIIAFGFGSGLIHPAPGTWGTLTGWLLWALFL
RGLPDAWMVAVLIVSFGLGCWVAQRCGDALGIPDHGGINWDEIVAIWLVLWLMPEGFWSQ
LAGVILFRIFDILKPPPVSVLDRRFKSGFGVMIDDIVAALYALLAAAILIRLGVLP