Protein Info for ABCV34_RS08510 in Castellaniella sp019104865 MT123

Annotation: branched-chain amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 345 transmembrane" amino acids 13 to 56 (44 residues), see Phobius details amino acids 64 to 83 (20 residues), see Phobius details amino acids 95 to 113 (19 residues), see Phobius details amino acids 119 to 138 (20 residues), see Phobius details amino acids 150 to 173 (24 residues), see Phobius details amino acids 194 to 216 (23 residues), see Phobius details amino acids 245 to 271 (27 residues), see Phobius details amino acids 283 to 308 (26 residues), see Phobius details amino acids 319 to 337 (19 residues), see Phobius details PF02653: BPD_transp_2" amino acids 12 to 330 (319 residues), 69.2 bits, see alignment E=1.6e-23

Best Hits

KEGG orthology group: K01997, branched-chain amino acid transport system permease protein (inferred from 75% identity to put:PT7_1731)

Predicted SEED Role

"High-affinity branched-chain amino acid transport system permease protein LivH (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (345 amino acids)

>ABCV34_RS08510 branched-chain amino acid ABC transporter permease (Castellaniella sp019104865 MT123)
MDLTIALILLQDGILNGAIYALLGLALVLVFLVTRVIFIPQGEFVTFGALSLAFLANGRV
PGTAYLLLLLGVLTCLVEAVSAWRTHQWRGYGRTLAWALILPLALLALAPMAAAPGVPLA
LRVLFALALVIPLGPMIYRLVYQPVEQASVLVLLIISVAVHFALTGLGLLFFGAEGWRTP
ALVEGTVQIGPVAWTAQTFAVLGTCVVLIAALWLFFGRTLYGRALRATAVNRRGARLVGI
STRVAGGLTFTLAAAIGALSGMLIAAITTIYYDTGFLIGLKGFVAAIFGGLISYPAAAAG
ALFVGVLEAFSSFWASPFKEAIVFTLIIPVLLWRSLGSVQLDEED