Protein Info for ABCV34_RS07250 in Castellaniella sp019104865 MT123

Annotation: NAD(P)H-dependent oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03358: FMN_red
  • amino acids 6 to 149 (144 residues), 130.5 bits, E=4e-42
• PF02525: Flavodoxin_2
  • amino acids 7 to 136 (130 residues), 31.4 bits, E=1.5e-11

Best Hits

Swiss-Prot: 56% identical to CHRR_PSEPU: Quinone reductase (chrR) from Pseudomonas putida

KEGG orthology group: None (inferred from 62% identity to reu:Reut_A2018)

MetaCyc: 54% identical to quinone reductase (Pseudomonas putida KT2440)
RXN0-5330 [EC: 1.6.5.9]

Predicted SEED Role

No annotation

MetaCyc Pathways

• NADH to cytochrome bd oxidase electron transfer II (2/2 steps found)
• mitochondrial NADPH production (yeast) (4/5 steps found)
• superpathway of NAD/NADP - NADH/NADPH interconversion (yeast) (6/8 steps found)
• aerobic respiration II (cytochrome c) (yeast) (3/4 steps found)
• NADH to cytochrome bo oxidase electron transfer II (1/2 steps found)
• nitrate reduction VIIIb (dissimilatory) (1/2 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.6.5.9

Protein Sequence (186 amino acids)

>ABCV34_RS07250 NAD(P)H-dependent oxidoreductase (Castellaniella sp019104865 MT123)
MAKNVDVAVIVGSLRKDSFNRKIAQNLAALAPEPLVLTIVEIGQLPLYNQDYDAASPAEY
TPFRARIKQADALLFVTPEHDRSMPAALKNALDIGGRPWGQSVWAGKPAGIVSASIGATG
AFGANHHLRQTLTYLDTPTMLQPEAYIGKVDTLLDEKGGINNDGTRDFLRGYMAAYAKWV
KHFVAA