Protein Info for ABCV34_RS06800 in Castellaniella sp019104865 MT123

Annotation: tRNA 2-thiouridine(34) synthase MnmA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 368 PF03054: tRNA_Me_trans" amino acids 7 to 205 (199 residues), 268.1 bits, see alignment E=1e-83 TIGR00420: tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase" amino acids 7 to 367 (361 residues), 420.8 bits, see alignment E=1.8e-130 PF02540: NAD_synthase" amino acids 7 to 74 (68 residues), 21.3 bits, see alignment E=2.6e-08 PF20259: tRNA_Me_trans_M" amino acids 211 to 283 (73 residues), 66.2 bits, see alignment E=3.2e-22 PF20258: tRNA_Me_trans_C" amino acids 294 to 367 (74 residues), 77.9 bits, see alignment E=1.2e-25

Best Hits

Swiss-Prot: 81% identical to MNMA_BORBR: tRNA-specific 2-thiouridylase MnmA (mnmA) from Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)

KEGG orthology group: K00566, tRNA-specific 2-thiouridylase [EC: 2.8.1.-] (inferred from 81% identity to bpe:BP2893)

MetaCyc: 58% identical to tRNA-specific 2-thiouridylase (Escherichia coli K-12 substr. MG1655)
RXN0-2023 [EC: 2.8.1.13]

Predicted SEED Role

"tRNA-specific 2-thiouridylase MnmA"

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 2.8.1.-

Use Curated BLAST to search for 2.8.1.- or 2.8.1.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (368 amino acids)

>ABCV34_RS06800 tRNA 2-thiouridine(34) synthase MnmA (Castellaniella sp019104865 MT123)
MPAPGARIVVGMSGGVDSSVSAWLLKQQGYQVIGLFMKNWEDDDDSEYCSSRQDWLDAAS
VADVVGVDIEAVNFAAEYKDRVFAEFLREYSAGRTPNPDVLCNAEIKFKAFLDHAMSLGA
DYIATGHYARVRRVRTDAGVRSQLLKAVDATKDQSYFLHRLNQAQLSRTVFPLGEVRKTE
VRRIAHEIGLPNAAKKDSTGICFIGERPFREFLNRYLPTRPGPMRTPEGLPLGEHQGLAF
YTLGQRKGLGIGGVQGAQRDDGTADAWYVARKSMADNTLYVVQGHDHPWLLSPTLTAQDA
SWVAGEPPTPGAYGAKTRYRQADAPCTLSVRDAAAFSLAFQDPQWAVTPGQSAVLYDGEI
CLGGGIIA