Protein Info for ABCV34_RS04845 in Castellaniella sp019104865 MT123

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 401 transmembrane" amino acids 12 to 37 (26 residues), see Phobius details amino acids 284 to 306 (23 residues), see Phobius details amino acids 327 to 349 (23 residues), see Phobius details amino acids 368 to 389 (22 residues), see Phobius details PF12704: MacB_PCD" amino acids 23 to 255 (233 residues), 62.8 bits, see alignment E=5.6e-21 PF02687: FtsX" amino acids 286 to 395 (110 residues), 60.4 bits, see alignment E=1.7e-20

Best Hits

KEGG orthology group: K02004, (no description) (inferred from 96% identity to dac:Daci_2684)

Predicted SEED Role

"ABC transporter, permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (401 amino acids)

>ABCV34_RS04845 ABC transporter permease (Castellaniella sp019104865 MT123)
MISLAGRDILHAWGKFVFTGIGLGLLIGVTLVMAGVYRGMVDDGKALLDNSGADLWVVQK
DTLGPYAESSSLNDDAYRAILAMPGVARAANVTYLTMQVRKGETDVRTMVVGIAPGELGA
TPGWPPYLVAGRQITRGHYEAVADIATGFKLGDRLAVRRNHYTVVGLTKRMVSSSGDPMV
FIPLKDAQEAQFLKDNDAIWQSRRRTEANPALNRPGVPGLLDAVIASQSTNPFVNAVLVT
LKPGHAPEDVAEPIRRWKRLTVYTRAQMEGILVGKLIATSAKQIGMFLVILAIVSAAIVA
FIIYTLTMDKIREIAVLKLIGTRNRTIAAMIMQQSLALGVIGFVVGKITATFSAPLFPKY
VLLMPVDSIAGFFAVLVICVLASIVAIRMALKVDPAEAIGG