Protein Info for ABCV34_RS04825 in Castellaniella sp019104865 MT123

Annotation: chemotaxis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 321 PF01584: CheW" amino acids 22 to 164 (143 residues), 90 bits, see alignment E=1.1e-29 PF00072: Response_reg" amino acids 191 to 313 (123 residues), 51 bits, see alignment E=1.6e-17

Best Hits

KEGG orthology group: K03415, two-component system, chemotaxis family, response regulator CheV (inferred from 68% identity to vei:Veis_1763)

Predicted SEED Role

"Chemotaxis protein CheV (EC 2.7.3.-)" in subsystem Bacterial Chemotaxis or Flagellar motility (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.3.-

Use Curated BLAST to search for 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (321 amino acids)

>ABCV34_RS04825 chemotaxis protein (Castellaniella sp019104865 MT123)
MSPSQHAVDDRASLTGTNRFELLLFRLGTDNDSGQSELFGINVLKVREIVTMPAVTAVVG
APKHSLGVVQLRDQVIPVFDLPGIVGSKLSAPPSLMLVTEFGRTTQAFTVESVDDIVRLD
WNQVISAEASGTAHSLVTSMARLDDDAGNTRLAQVLDVEAILQTVTPVKDRHQVDPKDVG
DQIQLKPGTVILMADDSFVARALMEQALKALKVPYEMVKSGREAWDRLNVLKAAAEAEGK
TILDKVSLMLTDLEMPEMDGFTLTRNIKQDARMRALPVVIHSSLSGSANEDHVRSVGADG
YVAKFSAEELSSTIRKVLARP