Protein Info for ABCV34_RS04240 in Castellaniella sp019104865 MT123

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 295 transmembrane" amino acids 7 to 30 (24 residues), see Phobius details amino acids 59 to 81 (23 residues), see Phobius details amino acids 88 to 106 (19 residues), see Phobius details amino acids 136 to 160 (25 residues), see Phobius details amino acids 181 to 201 (21 residues), see Phobius details amino acids 209 to 228 (20 residues), see Phobius details amino acids 237 to 257 (21 residues), see Phobius details amino acids 269 to 286 (18 residues), see Phobius details PF02653: BPD_transp_2" amino acids 13 to 259 (247 residues), 97.3 bits, see alignment E=4.4e-32

Best Hits

KEGG orthology group: K05832, putative ABC transport system permease protein (inferred from 79% identity to put:PT7_1001)

Predicted SEED Role

"ABC transporter permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (295 amino acids)

>ABCV34_RS04240 ABC transporter permease (Castellaniella sp019104865 MT123)
MSIYSMWGALEIGLIFGLVALGVLISFRVLNFPDLTVDGSFPLGGATAAILIHHGVDPFL
ATLAATLAAGLAGVITGWLNVSLKIMDLLASILVMIALYSINLRVMSAPNVPLITDPTVF
TQLQPAGMEDYIARPLILLALVVAVKLLLDWFFATQVGLAMRSTGSNPRMARSQGIHTGR
MILLGMAISNALCGLAGALFAQSQGGADISMGIGTIVIGLAAVIIGESILPTRRLMLATL
AVVIGAVLYRFFIALALNADFVGLKAQDLNLVTAVLVTVALVIPLVKQRLLKKRA