Protein Info for ABCV34_RS04165 in Castellaniella sp019104865 MT123

Annotation: PAS domain S-box protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 585 transmembrane" amino acids 26 to 49 (24 residues), see Phobius details amino acids 69 to 89 (21 residues), see Phobius details PF00989: PAS" amino acids 108 to 220 (113 residues), 57.7 bits, see alignment E=3.4e-19 PF13188: PAS_8" amino acids 108 to 156 (49 residues), 30.9 bits, see alignment 5.7e-11 amino acids 235 to 293 (59 residues), 20.7 bits, see alignment 8.9e-08 TIGR00229: PAS domain S-box protein" amino acids 108 to 230 (123 residues), 91.4 bits, see alignment E=2.5e-30 PF08448: PAS_4" amino acids 116 to 225 (110 residues), 64.2 bits, see alignment E=3.7e-21 PF13426: PAS_9" amino acids 124 to 222 (99 residues), 49.5 bits, see alignment E=1.3e-16 PF00512: HisKA" amino acids 354 to 421 (68 residues), 39.8 bits, see alignment E=1.2e-13 PF02518: HATPase_c" amino acids 466 to 570 (105 residues), 75.2 bits, see alignment E=1.7e-24

Best Hits

KEGG orthology group: None (inferred from 85% identity to put:PT7_1014)

Predicted SEED Role

"tw-component sensor kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (585 amino acids)

>ABCV34_RS04165 PAS domain S-box protein (Castellaniella sp019104865 MT123)
MAMAHPNRKSLIPTTFYEHARHSRRLYWLTPAIVLVLYLCVMGAFIWLQRLQSDSVMFVT
IDQETRQQRLMMVVFALSLVIVFSLLALWRYTRFRTLAEAALIAETGFRRAMENSMSTGM
RVFDMQGRIAYVNPAFCRMIGWNEADLIGRTAPFPYWLPGRHDHHRETLAQLLSGRTPSS
GLEIEAQRRDGSRFTARMYVSPLRDPKGEQIGWMTSMTDITEPKRIREALTAAHERFMTV
LEGLDDAISVVADTPEGLELLFANRTYRRIFGAQTSGHAELLGGRLGRFTDETMELFSPT
AERWFEVHHRMLAWTDSRRVRLQVARDITERRKHEEESRVQQEKAQLTSRLTTMGEMASS
LAHELNQPLTAISNYNMAAVAMVKSGKAPTESLLQALEKASQQAERAGKIISRIREFVKR
SEPRRQAVGLTRIVENAVGFADIDARKRRIEIIQSLPDPMPEVMADPILIEQVLLNLLKN
GVEAMEHSEYRSLHVNITDQDPQIEIAVIDRGHGLRNPERLFEPFYSTKSEGLGMGLNIC
RTIIESHHGRLWATPNPEGGTIFRFTLPKAPPDRQVQATTEETQA