Protein Info for ABCV34_RS02840 in Castellaniella sp019104865 MT123

Annotation: branched-chain amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 346 transmembrane" amino acids 33 to 91 (59 residues), see Phobius details amino acids 103 to 125 (23 residues), see Phobius details amino acids 132 to 146 (15 residues), see Phobius details amino acids 176 to 196 (21 residues), see Phobius details amino acids 229 to 248 (20 residues), see Phobius details amino acids 268 to 294 (27 residues), see Phobius details amino acids 304 to 327 (24 residues), see Phobius details PF02653: BPD_transp_2" amino acids 52 to 316 (265 residues), 117.5 bits, see alignment E=3.1e-38

Best Hits

KEGG orthology group: K01998, branched-chain amino acid transport system permease protein (inferred from 64% identity to hse:Hsero_3998)

Predicted SEED Role

"Branched-chain amino acid transport system permease protein LivM (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (346 amino acids)

>ABCV34_RS02840 branched-chain amino acid ABC transporter permease (Castellaniella sp019104865 MT123)
MTTSSLPGTGSVPRREDLLDRYRRTAHWKPLEYVFWCLPILAYFAFPGNYLLLSQIAITG
LFALSLDLIFGYAGIISLGHAAFFGVGAYTVGLLGSHGLGDPLLGLLLAAVFAGLLGFLS
SFLLLRGSDLSRLMVTLGVALMLYELANKFTRITGGVDGMPGIEIKPILGVFDFDMFGRV
GFIYSVVVLFVLFWVARRLVYSPFGQSLRGIHMNVLRMPALGVPVNRRLVQIYTIGAAYA
GVAGALLAQTNQFVSLDVLSFQRSADLLLILILGGAGHLYGGLIGAVVFVMINYFLSDMN
PQYWQFWLGLILVLVVLFARGGILGTAQQWIRSSRQRAQAKTETSA