Protein Info for ABCV34_RS00925 in Castellaniella sp019104865 MT123
Annotation: NAD(P)-dependent oxidoreductase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 34% identical to LTND_CUPNH: L-threonate dehydrogenase (ltnD) from Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337)
KEGG orthology group: None (inferred from 58% identity to bpt:Bpet4869)Predicted SEED Role
"2-hydroxy-3-oxopropionate reductase (EC 1.1.1.60)" in subsystem Allantoin Utilization or D-galactarate, D-glucarate and D-glycerate catabolism or Photorespiration (oxidative C2 cycle) (EC 1.1.1.60)
MetaCyc Pathways
- glycolate and glyoxylate degradation I (3/4 steps found)
- superpathway of glycol metabolism and degradation (5/7 steps found)
- D-glucarate degradation I (2/4 steps found)
- superpathway of D-glucarate and D-galactarate degradation (2/5 steps found)
- D-galactarate degradation I (1/4 steps found)
- superpathway of microbial D-galacturonate and D-glucuronate degradation (13/31 steps found)
KEGG Metabolic Maps
Isozymes
Compare fitness of predicted isozymes for: 1.1.1.60
Use Curated BLAST to search for 1.1.1.60
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (291 amino acids)
>ABCV34_RS00925 NAD(P)-dependent oxidoreductase (Castellaniella sp019104865 MT123) MKIGFCGLGRMGVPMVRRLLQAGHQVHVWNRSPAPVRQLAAEGAQAHATPRELADACAWV ALCLFDAAAVESVVFGADGLAGSGSLRVLVDHSSIPPTDTRIFADRLAQANGAIWLDAPV SGGTGGAAAGTLAIMAGGPADVCDQVAPVLRAYAQRVTHLGPVGAGQVAKLCNQTIVATT IAAIAEAVALAQDAGVDAVRLTEALAGGWADSTLLRIFVPRMTQAPAEAQASLDTMLKDL DTVAALARSQGTAVPVATAAGQNYRLASRHGLGAADVSQLIRLFDRAGDRA