Protein Info for ABCV34_RS00925 in Castellaniella sp019104865 MT123

Annotation: NAD(P)-dependent oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 291 PF03807: F420_oxidored" amino acids 2 to 64 (63 residues), 29.6 bits, see alignment E=1.3e-10 PF03446: NAD_binding_2" amino acids 2 to 161 (160 residues), 153.2 bits, see alignment E=9.4e-49 PF14833: NAD_binding_11" amino acids 164 to 283 (120 residues), 96.4 bits, see alignment E=2.2e-31

Best Hits

Swiss-Prot: 34% identical to LTND_CUPNH: L-threonate dehydrogenase (ltnD) from Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337)

KEGG orthology group: None (inferred from 58% identity to bpt:Bpet4869)

Predicted SEED Role

"2-hydroxy-3-oxopropionate reductase (EC 1.1.1.60)" in subsystem Allantoin Utilization or D-galactarate, D-glucarate and D-glycerate catabolism or Photorespiration (oxidative C2 cycle) (EC 1.1.1.60)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.60

Use Curated BLAST to search for 1.1.1.60

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (291 amino acids)

>ABCV34_RS00925 NAD(P)-dependent oxidoreductase (Castellaniella sp019104865 MT123)
MKIGFCGLGRMGVPMVRRLLQAGHQVHVWNRSPAPVRQLAAEGAQAHATPRELADACAWV
ALCLFDAAAVESVVFGADGLAGSGSLRVLVDHSSIPPTDTRIFADRLAQANGAIWLDAPV
SGGTGGAAAGTLAIMAGGPADVCDQVAPVLRAYAQRVTHLGPVGAGQVAKLCNQTIVATT
IAAIAEAVALAQDAGVDAVRLTEALAGGWADSTLLRIFVPRMTQAPAEAQASLDTMLKDL
DTVAALARSQGTAVPVATAAGQNYRLASRHGLGAADVSQLIRLFDRAGDRA