Protein Info for ABCV34_RS00330 in Castellaniella sp019104865 MT123

Annotation: amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 222 transmembrane" amino acids 15 to 42 (28 residues), see Phobius details amino acids 55 to 78 (24 residues), see Phobius details amino acids 84 to 104 (21 residues), see Phobius details amino acids 150 to 151 (2 residues), see Phobius details amino acids 154 to 158 (5 residues), see Phobius details amino acids 189 to 208 (20 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 12 to 110 (99 residues), 93.2 bits, see alignment E=6e-31 PF00528: BPD_transp_1" amino acids 35 to 215 (181 residues), 88.7 bits, see alignment E=2.1e-29

Best Hits

Swiss-Prot: 30% identical to ARTM_HAEIN: Arginine ABC transporter permease protein ArtM (artM) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 77% identity to bpt:Bpet2496)

Predicted SEED Role

"Amino acid ABC transporter, permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (222 amino acids)

>ABCV34_RS00330 amino acid ABC transporter permease (Castellaniella sp019104865 MT123)
MNFDFTPAWTNWQALLSGAAVTVEVTVGALVLSCLLGLLIGIGRLNPQHKLPYRICSVYL
SMFRGTPLLVQLFIWFFGLPRFNILLPAFVCGVLGLGMYSASYVSEVVRGAIQSIDRGQM
EAARSLGMSSRQAMIKIILPQAFIRMIPPLGNEFISLIKNSALVSLVTIHDLMHEGQKII
SVSYRSLEIYLVIAVIYWIMTTFTTTVLRRVELRMQAGGMVQ