Protein Info for DvMF_3202 in Desulfovibrio vulgaris Miyazaki F

Name: ruvC
Annotation: Holliday junction resolvase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 197 PF02075: RuvC" amino acids 38 to 184 (147 residues), 148.6 bits, see alignment E=6.5e-48 TIGR00228: crossover junction endodeoxyribonuclease RuvC" amino acids 38 to 187 (150 residues), 134.8 bits, see alignment E=1.2e-43

Best Hits

Swiss-Prot: 77% identical to RUVC_DESVH: Crossover junction endodeoxyribonuclease RuvC (ruvC) from Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / DSM 644 / NCIMB 8303)

KEGG orthology group: K01159, crossover junction endodeoxyribonuclease RuvC [EC: 3.1.22.4] (inferred from 100% identity to dvm:DvMF_3202)

Predicted SEED Role

"Crossover junction endodeoxyribonuclease RuvC (EC 3.1.22.4)" in subsystem DNA-replication or RuvABC plus a hypothetical (EC 3.1.22.4)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.22.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DNJ6 at UniProt or InterPro

Protein Sequence (197 amino acids)

>DvMF_3202 Holliday junction resolvase (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MPPRKPASPQAEAPASPVSVTSGATSGVVGGNVGGVTVIGIDPGSQCTGWGVVREMSGVL
TLVDCGAIRPKGDDFAARLGHLFRELHALVGRYAPDEAAIENVHAARNVATALKLGQARG
VAVAACAAHGVVVADYQPTEIKKALVGTGGADKEQVSFMVARVLGAKGGWGLDTGDALAA
AVCHLNARRLSRLARLG