Protein Info for DvMF_3158 in Desulfovibrio vulgaris Miyazaki F

Annotation: carboxyl-terminal protease (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 433 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details PF22694: CtpB_N-like" amino acids 34 to 84 (51 residues), 35.5 bits, see alignment 2.9e-12 TIGR00225: C-terminal processing peptidase" amino acids 53 to 367 (315 residues), 343.6 bits, see alignment E=5.5e-107 PF00595: PDZ" amino acids 96 to 167 (72 residues), 49 bits, see alignment E=1.7e-16 PF13180: PDZ_2" amino acids 102 to 172 (71 residues), 44.5 bits, see alignment E=3.9e-15 PF17820: PDZ_6" amino acids 114 to 167 (54 residues), 46.9 bits, see alignment 4.5e-16 PF03572: Peptidase_S41" amino acids 202 to 361 (160 residues), 196.2 bits, see alignment E=7.1e-62

Best Hits

Swiss-Prot: 45% identical to CTPA_BARBK: Carboxy-terminal-processing protease (ctpA) from Bartonella bacilliformis (strain ATCC 35685 / NCTC 12138 / KC583)

KEGG orthology group: K03797, carboxyl-terminal processing protease [EC: 3.4.21.102] (inferred from 100% identity to dvm:DvMF_3158)

Predicted SEED Role

"Carboxyl-terminal protease (EC 3.4.21.102)" (EC 3.4.21.102)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.21.102

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DNF2 at UniProt or InterPro

Protein Sequence (433 amino acids)

>DvMF_3158 carboxyl-terminal protease (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MRVTLWTATLLILGVLAISGGAALVPDTVGAASEEGKYDSLKRFSQVLDLVERYYVRDVP
RKDLINGAVKGMLQGLDPHSTFLSVEEFKEMQESTSGEFFGIGIEISSENGQLIVVAPIE
DTPAHKAGLKSGDIILAVDGVPTQDMTTQEAVTRIRGAKGTEVELSILHRDAKAPEVVRL
VRDAIPLISVKSKMLEDGYHWVRLTRFSERTTGELVDALKEANKKGMKGIILDLRNNPGG
LLDQAVSVSDTFLKDGVIVSIRGRMEDASREYRAKAQPGDVTVPMVVLVNAGSASASEIV
AGALRDHNRALILGERTFGKGSVQNVIPLSDGAGLKLTVALYYTPNGRSIQAEGVEPDFE
VPFELPREEEKAHRLNMVREKDLNRHLENGSSGKDARPSAKAADDVKQALEKDNQLRMAL
QFVKRLPRLKDIQ