Protein Info for DvMF_3141 in Desulfovibrio vulgaris Miyazaki F

Annotation: tRNA guanosine-2'-O-methyltransferase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 187 transmembrane" amino acids 136 to 154 (19 residues), see Phobius details PF00588: SpoU_methylase" amino acids 15 to 154 (140 residues), 125.3 bits, see alignment E=1.1e-40

Best Hits

Swiss-Prot: 46% identical to TRMH_THET2: tRNA (guanosine(18)-2'-O)-methyltransferase (trmH) from Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039)

KEGG orthology group: K00556, tRNA (guanosine-2'-O-)-methyltransferase [EC: 2.1.1.34] (inferred from 100% identity to dvm:DvMF_3141)

Predicted SEED Role

"tRNA (guanosine(18)-2'-O)-methyltransferase (EC 2.1.1.34)" (EC 2.1.1.34)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.34

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DND5 at UniProt or InterPro

Protein Sequence (187 amino acids)

>DvMF_3141 tRNA guanosine-2'-O-methyltransferase (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MERIRRVLGWRQKDLTLVLANIHDPHNVSAIYRSCDAFGVAQVHLYYTDTAFPVLGRKSS
ASARKWVDTVRHSDAQSLMRTLKEGGHRVLATSCTPAAKPLGDYDMTQPTAIIMGNEHSG
VAPELVELVDGEVYIPMYGMIQSFNVSVAAAVLLAEASRQRVLAGMYDRPSWPEEELEAR
IAAWAEK