Protein Info for DvMF_3125 in Desulfovibrio vulgaris Miyazaki F

Name: guaA
Annotation: GMP synthase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00888: GMP synthase (glutamine-hydrolyzing), N-terminal domain
  • amino acids 7 to 195 (189 residues), 220.6 bits, E=1.1e-69
• PF00117: GATase
  • amino acids 9 to 191 (183 residues), 130.8 bits, E=2e-41
• PF07722: Peptidase_C26
  • amino acids 70 to 174 (105 residues), 29.8 bits, E=2.1e-10
• TIGR00884: GMP synthase (glutamine-hydrolyzing), C-terminal domain
  • amino acids 204 to 515 (312 residues), 501.3 bits, E=1.1e-154
• PF02540: NAD_synthase
  • amino acids 206 to 245 (40 residues), 25.1 bits, 3.6e-09
• PF00733: Asn_synthase
  • amino acids 215 to 251 (37 residues), 21.6 bits, 6.3e-08
• PF01507: PAPS_reduct
  • amino acids 221 to 297 (77 residues), 25.7 bits, E=4.2e-09
• PF00958: GMP_synt_C
  • amino acids 424 to 514 (91 residues), 148.3 bits, E=2.1e-47

Best Hits

Swiss-Prot: 100% identical to GUAA_DESVM: GMP synthase [glutamine-hydrolyzing] (guaA) from Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637)

KEGG orthology group: K01951, GMP synthase (glutamine-hydrolysing) [EC: 6.3.5.2] (inferred from 100% identity to dvm:DvMF_3125)

MetaCyc: 53% identical to GMP synthetase (Escherichia coli K-12 substr. MG1655)
GMP synthase (glutamine-hydrolyzing). [EC: 6.3.5.2]; 6.3.5.2 [EC: 6.3.5.2]

Predicted SEED Role

No annotation

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (42/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (23/26 steps found)
• superpathway of purine nucleotide salvage (13/14 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis I (6/6 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis II (7/8 steps found)
• L-asparagine biosynthesis III (tRNA-dependent) (4/4 steps found)
• guanosine ribonucleotides de novo biosynthesis (4/4 steps found)
• ammonia assimilation cycle III (3/3 steps found)
• L-glutamate biosynthesis I (2/2 steps found)
• L-glutamine degradation I (1/1 steps found)
• glutaminyl-tRNA^gln biosynthesis via transamidation (3/4 steps found)
• L-citrulline biosynthesis (5/8 steps found)
• L-glutamate and L-glutamine biosynthesis (4/7 steps found)
• superpathway of L-citrulline metabolism (7/12 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Drug metabolism - other enzymes
• Glutamate metabolism
• Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.5.2

Sequence Analysis Tools

See B8DNB9 at UniProt or InterPro

Protein Sequence (515 amino acids)

>DvMF_3125 GMP synthase (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MEAQTKVIIIDYGSQVTQLIARRVREAGVYSEIHPCIVTADQVRAMKPAAVILSGGPASV
GEADAPTLEKGLLELGVPVLAICYGMQLLGHNLGGQLATSETREYGPADLTLLGDCPLWD
GIDKSATTRVWMSHGDKVKTPPPGFAVVGRTATLDVAAMADDARRIYAVQFHPEVHHTEE
GTRIINNFLFHVAKLKADWTMSSFVERAIKEMAETVGDRHVVCALSGGIDSTVVAVLLHK
AIGKRLHCIFVDNGVLRLNEGQEVVDYLREHFDLNLKYVQAQRRFLDKLEGVEDPEQKRK
IIGYTFIEVFDEEAKALGHVDFLAQGTLYPDVIESVSHKGPSAVIKSHHNVGGLPEKMNL
KLIEPLRELFKDEVRKVAGELGLPDFIIWRHPFPGPGLAIRVIGEITEERLDILRKADKI
VQAELMSSGWYRKVWQGFAVLLPLKTVGVMGDGRTYEHVIALRIVDSVDAMTADWARLPS
ELLERISSRIINEVKGVNRVVYDISSKPPSTIEWE