Protein Info for DvMF_3109 in Desulfovibrio vulgaris Miyazaki F

Annotation: dolichyl-phosphate-mannose-protein mannosyltransferase family protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 665 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details transmembrane" amino acids 75 to 96 (22 residues), see Phobius details amino acids 108 to 126 (19 residues), see Phobius details amino acids 131 to 148 (18 residues), see Phobius details amino acids 156 to 189 (34 residues), see Phobius details amino acids 201 to 221 (21 residues), see Phobius details amino acids 251 to 274 (24 residues), see Phobius details amino acids 295 to 313 (19 residues), see Phobius details amino acids 318 to 337 (20 residues), see Phobius details amino acids 347 to 370 (24 residues), see Phobius details amino acids 388 to 408 (21 residues), see Phobius details amino acids 420 to 439 (20 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 98% identity to dvm:DvMF_3109)

Predicted SEED Role

"Polymyxin resistance protein ArnT, undecaprenyl phosphate-alpha-L-Ara4N transferase; Melittin resistance protein PqaB"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DJG9 at UniProt or InterPro

Protein Sequence (665 amino acids)

>DvMF_3109 dolichyl-phosphate-mannose-protein mannosyltransferase family protein (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MPLTLIYAAQTAFTLDARSLWFSDEIRHGNVYETMLATGQWLVPHLNGIPYPDKPPVYFW
FLGLLDAIPGVDGPMVFQLGAAVSGLLVLWATYALARLVAGCDKRESFAAGLVLLCGMYF
LGVTHYARMDLLFAAVITLAHICMYRGLRLPLAFRWVIPAFALAAVATLIKGPFGLAFPL
LAGLAYGLWRGMPRRLNRMDVAIGGGIMLATLLAWVGAVWFEGYADLIRNILRHQIVDRA
TAAWHHEQPWWHYLATLPVAWLPFTLVLPFLPWGRAFSPASMRSVLATRKGQGDGMAYIW
LALVTSFALLTAVSIKIVIYLLPLFPLLAVVTARALLRLNGFGSRMYFGLTALVLFVLAL
GLGAASLWQWAPDMVRVRFQPQVLALLDIARGAPILAGITLVFAVLLWKAVDRSRPEGGL
LTLAAFVTALVVPAALFTAPSLDPVMSPRAQAELMGEYIRKGYHPVSYKVYSGTYTYYAG
ANIEELSDEDSLRAATAVFPQLVVAMRADRFAEWADKPADLREVHRQWIVDREYVLAERS
GPIQPAQPAQSDGTATPAPGGDGSAPAVTGDQAPAPDAPALPQPAPAESNGTAPAAHQPA
QPAQPAQPGQQPATPEAPAVPLPGPQPQDNAPATPQPVPVPTPPPPPPGVGATDTPTAPS
TAQAQ