Protein Info for DvMF_3091 in Desulfovibrio vulgaris Miyazaki F

Annotation: NusB antitermination factor (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 165 signal peptide" amino acids 1 to 34 (34 residues), see Phobius details TIGR01951: transcription antitermination factor NusB" amino acids 10 to 154 (145 residues), 128.8 bits, see alignment E=7.6e-42 PF01029: NusB" amino acids 12 to 153 (142 residues), 122.3 bits, see alignment E=9.2e-40

Best Hits

Swiss-Prot: 100% identical to NUSB_DESVM: Transcription antitermination protein NusB (nusB) from Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637)

KEGG orthology group: K03625, N utilization substance protein B (inferred from 100% identity to dvm:DvMF_3091)

Predicted SEED Role

"Transcription termination protein NusB" in subsystem Transcription factors bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DJF1 at UniProt or InterPro

Protein Sequence (165 amino acids)

>DvMF_3091 NusB antitermination factor (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MANQGKKPTRRSERALAFQVLYGLSFTPATSEGALRAAYAASPDVADRNAEDEKADRQAP
ATAPQGYAWEVIHGVWKTQAELDEAVSGFSQNWRVERMGRVELTLLRIAVYEMLFRDDVP
AKVAMNEAIELSKQFGDDNSRGFINGILDAVARAVESGRLTPKGQ