Protein Info for DvMF_3053 in Desulfovibrio vulgaris Miyazaki F

Annotation: 4Fe-4S ferredoxin, iron-sulfur binding domain protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 272 transmembrane" amino acids 34 to 56 (23 residues), see Phobius details amino acids 86 to 107 (22 residues), see Phobius details amino acids 128 to 150 (23 residues), see Phobius details amino acids 182 to 204 (23 residues), see Phobius details PF12801: Fer4_5" amino acids 86 to 118 (33 residues), 31.7 bits, see alignment 5.9e-12 amino acids 185 to 218 (34 residues), 15.3 bits, see alignment 8e-07

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvm:DvMF_3053)

Predicted SEED Role

"FIG01197297: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DJB3 at UniProt or InterPro

Protein Sequence (272 amino acids)

>DvMF_3053 4Fe-4S ferredoxin, iron-sulfur binding domain protein (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MSDAGVSTVHAAGGTANLTELKPRLGARARAVRLWNRAAQAVMLLLIGQWSFYGIFRCPF
VVPYISCQNCPVVACHGRLFTMFWGVWAGWLALAALFGRAFCGWACPGGTVNRLLGLFAP
LRLKPGGLAARLLPFGKYGGLALALWAYFVLGQPRVNVPIRTGEFFGAVALTFEHAMPLW
LVRTWAVVGILALGVAVSAAWCRFACPAGGVLEAVRRFAPFSVYKTDACNGCDKCRKACY
MATRPEETNCTNCGDCLGSCPQDCIGMGRKPR