Protein Info for DvMF_3035 in Desulfovibrio vulgaris Miyazaki F

Annotation: glycosyl transferase family 9 (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 341 PF01075: Glyco_transf_9" amino acids 76 to 313 (238 residues), 53.3 bits, see alignment E=1.3e-18

Best Hits

KEGG orthology group: K02849, heptosyltransferase III [EC: 2.4.-.-] (inferred from 100% identity to dvm:DvMF_3035)

Predicted SEED Role

"Lipopolysaccharide heptosyltransferase III (EC 2.4.1.-)" in subsystem LOS core oligosaccharide biosynthesis (EC 2.4.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.-.-, 2.4.1.-

Use Curated BLAST to search for 2.4.-.- or 2.4.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DJ95 at UniProt or InterPro

Protein Sequence (341 amino acids)

>DvMF_3035 glycosyl transferase family 9 (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MRRILVCQLRQIGDVLLATPSLELLHRHFPDAEVHVLTERKCTPMLQGNPAVHTVWAIDK
KDLGSIAREVAFYWRVARTGFDVVVDFQQLPRCRWVVAMSRARVRLSYTPAWYNRWLFTH
WVRPRDGYAAMAKASVLEPLGVRWNGERPRLYLSDTERDAARALLASLGLAEGQRLITVD
PTHRRATRRWPAAHYGRLLSLAAAHDPSLRFMPLFGPGEEDDVRAVVDACDCPEKVLMPD
RMLSLREMAACMAEAVLHVGNCSAPCHIAVAVGTPTFVVRGATSRAWSFPAPEHFHMALG
LDCQPCNRNECANPDQLACLVRLTPESVCQAMLEHLADVSR