Protein Info for DvMF_2995 in Desulfovibrio vulgaris Miyazaki F

Annotation: ABC transporter related (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 254 PF00005: ABC_tran" amino acids 51 to 199 (149 residues), 122 bits, see alignment E=2.8e-39

Best Hits

Swiss-Prot: 79% identical to LOLD_DESVH: Lipoprotein-releasing system ATP-binding protein LolD (lolD) from Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / DSM 644 / NCIMB 8303)

KEGG orthology group: K09810, lipoprotein-releasing system ATP-binding protein [EC: 3.6.3.-] (inferred from 100% identity to dvm:DvMF_2995)

MetaCyc: 54% identical to lipoprotein release complex - ATP binding subunit (Escherichia coli K-12 substr. MG1655)
RXN-22427

Predicted SEED Role

"Lipoprotein releasing system ATP-binding protein LolD"

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.-

Use Curated BLAST to search for 3.6.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DSH7 at UniProt or InterPro

Protein Sequence (254 amino acids)

>DvMF_2995 ABC transporter related (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MSTDFLHMTAPGQAPDASTRPSGGEGSGEPLYRLAGVDKEYDGPAEQLTILRGVDLSIRQ
GESVAIVGASGSGKSTLLHLLGTLDTPSQGQVLFQGRDMGAMSPDEKAGLRNREIGFVFQ
FHHLLPEFDTLENVAMQAIIAGMPRAQALARARDTLALVGLADRTAHRVTTLSGGERQRA
AIARAILMRPKVLLADEPTGNLDARTGDVVARLLLELNRELGMTLVIVTHNRELADLMGR
CLELRAGELYDQTR