Protein Info for DvMF_2993 in Desulfovibrio vulgaris Miyazaki F

Annotation: lysyl-tRNA synthetase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 501 TIGR00499: lysine--tRNA ligase" amino acids 11 to 500 (490 residues), 652.1 bits, see alignment E=2.6e-200 PF01336: tRNA_anti-codon" amino acids 66 to 141 (76 residues), 55.7 bits, see alignment E=5.8e-19 PF00152: tRNA-synt_2" amino acids 159 to 496 (338 residues), 303.7 bits, see alignment E=2e-94

Best Hits

Swiss-Prot: 55% identical to SYK_THISH: Lysine--tRNA ligase (lysS) from Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)

KEGG orthology group: K04567, lysyl-tRNA synthetase, class II [EC: 6.1.1.6] (inferred from 100% identity to dvm:DvMF_2993)

Predicted SEED Role

"Lysyl-tRNA synthetase (class II) (EC 6.1.1.6)" (EC 6.1.1.6)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.1.1.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DSH5 at UniProt or InterPro

Protein Sequence (501 amino acids)

>DvMF_2993 lysyl-tRNA synthetase (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MLESLETRDELNEVVKNRVVKSCELLDDGVALYPNGFVKQHDVAAISAEYEGLTAEELEN
VDTRFTCAGRIVSQRSFGKVTFFHLMDKSGRLQCYTAREVLGEDPYRNFKKLDIGDIVGV
SGTLFRTKTGELTLSCDQCILLTKSIRPLPEKYHGLKDVETRYRQRYVDLIVTPRTREIF
RKRTLIVREFRRFLEDKGFMEVETPMMQPIPGGATAMPFITHHNALDMQLYMRIAPELYL
KRLLVGGFEKVFEINRNFRNEGISTRHNPEFTMCEFYWAYATFEDLMDLTEQLFAHVAEK
VCGSYVVTYQGQEVDLTPGRWTRLSFHDSLEKIGGHKPEFYNDYEAVRKYIRERGEKVVD
GEKMAKLQAKLFDLDVEGKLIQPTFIYHYPTDISPLSRRNNERPDVTDRFELFITGRELG
NAFSELNDPVDQRMRFMDQVAEKEAGDAEAHFMDEDYLRALEYGMPPAAGEGVGIDRLVM
LLTDSPSIREVILFPLLKPES