Protein Info for DvMF_2990 in Desulfovibrio vulgaris Miyazaki F

Annotation: Isoprenylcysteine carboxyl methyltransferase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 226 transmembrane" amino acids 80 to 98 (19 residues), see Phobius details amino acids 110 to 128 (19 residues), see Phobius details amino acids 157 to 179 (23 residues), see Phobius details PF04140: ICMT" amino acids 113 to 200 (88 residues), 28.8 bits, see alignment E=1.4e-10 PF04191: PEMT" amino acids 138 to 205 (68 residues), 37.8 bits, see alignment E=2.2e-13

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvm:DvMF_2990)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DSH2 at UniProt or InterPro

Protein Sequence (226 amino acids)

>DvMF_2990 Isoprenylcysteine carboxyl methyltransferase (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MKHDHLDIAREYSALLRTDEADDRQPGSFRLPHGEGDHFGEPGMGGEGAAIPRVVPSHED
ERAGGVTPEDLSLWGAGPRIVVPALLAQLGGAALTLALPGPFGMGMLPHWAWVLMGACAL
LLGTLAVRRAWAELKPGRQEGRLVTGGPYRITRNPIYAAWILGILPGIALCFASWPMLAG
PVVAWALFRETVVVEESFLAARFGDAWDRYAARVNRLWPNPFRMQD