Protein Info for DvMF_2969 in Desulfovibrio vulgaris Miyazaki F

Annotation: ABC transporter related (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 418 PF00005: ABC_tran" amino acids 44 to 186 (143 residues), 130.1 bits, see alignment E=9.5e-42 PF08402: TOBE_2" amino acids 305 to 410 (106 residues), 29.7 bits, see alignment E=5.8e-11

Best Hits

KEGG orthology group: K02052, putative spermidine/putrescine transport system ATP-binding protein (inferred from 100% identity to dvm:DvMF_2969)

Predicted SEED Role

"Putrescine transport ATP-binding protein PotA (TC 3.A.1.11.1)" in subsystem Polyamine Metabolism (TC 3.A.1.11.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DSF1 at UniProt or InterPro

Protein Sequence (418 amino acids)

>DvMF_2969 ABC transporter related (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MPTDISPVASSDAFPNASPVASPSASADLSVTRLVKRFEKFTAVNDVSFEVEQGRFFSIL
GPSGCGKTTLLRMIAGFESPDSGVIAIRGRDMAGIAPNRRPVNLIFQHLALFPMMSVAEN
VAFGLKRRGMAGGEISRRVQDVLERVGLPGYGVKMPAQLSGGQKQRVAIARCLVLEPAVL
LLDEPLGALDLKLREQMKVELKTLQAEVGTTFVYITHDQSEALVMSDHVAVMNAGRFEQV
DTPRNLYRRPASAFVAGFVGETNVWSGTLEEATGDAGLVRTDEGAVFRARVAAGLAKGTR
VDMFIRPEAVLIDPDGASCATDGATDGATDGAAGDGAGGGDAPLPVRGACANRVQVQVQA
ILFDGAASRLLTHLEGSRREVMVALPQNRLYDHIKPGDRITVGWDDRAGICFAAGSGR