Protein Info for DvMF_2956 in Desulfovibrio vulgaris Miyazaki F

Annotation: efflux transporter, RND family, MFP subunit (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 430 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF16576: HlyD_D23" amino acids 43 to 306 (264 residues), 60.3 bits, see alignment E=3.5e-20 PF13533: Biotin_lipoyl_2" amino acids 67 to 107 (41 residues), 41.2 bits, see alignment 2.3e-14 TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 194 to 394 (201 residues), 101.5 bits, see alignment E=2.3e-33 PF13437: HlyD_3" amino acids 220 to 326 (107 residues), 56.9 bits, see alignment E=6.2e-19

Best Hits

KEGG orthology group: K02005, HlyD family secretion protein (inferred from 100% identity to dvm:DvMF_2956)

Predicted SEED Role

"FIG00603065: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DSD8 at UniProt or InterPro

Protein Sequence (430 amino acids)

>DvMF_2956 efflux transporter, RND family, MFP subunit (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MRKKIIIGLAIALAVALIAAYFLSRREGRTEITQTATVSRATVRKVLDATGIIKPEVGAI
VKTGTRFTGIIRTMHVKVGDAVKAGQIIAEIDDREQRAQQDQAEATLRKAQSELARVEAS
YPLQIREAEAQMAAAQADYDYAALNLKRRRTLVEQDLDARNTLDEAKQQSETTGNTLAAR
KATLDRLQRESTLAIKTAREAVKEAQSALEATNVRLSYSVIRAPLDGVVSEVTAQGGETV
VAGFQVANLITVLDPTRLEMWIYVDETDVGQITPGMTVEFRVDSLPGRTFGGTVNQIYPQ
PEIRDNIVYYRALVRLTPQTSTDLRPEMTTQCRIVVQQKDNVLAVPNEALKWVGGEQVVF
VQGDGAIRRVRPRIGLAGAETSEVLEGLAEGDVVGTKVVLPTSRGGGRPEQTPGGSGGPG
GGPGSGRPGR