Protein Info for DvMF_2917 in Desulfovibrio vulgaris Miyazaki F

Annotation: phosphatidate cytidylyltransferase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 268 transmembrane" amino acids 18 to 46 (29 residues), see Phobius details amino acids 58 to 75 (18 residues), see Phobius details amino acids 81 to 102 (22 residues), see Phobius details amino acids 115 to 134 (20 residues), see Phobius details amino acids 140 to 161 (22 residues), see Phobius details amino acids 175 to 195 (21 residues), see Phobius details amino acids 201 to 221 (21 residues), see Phobius details PF01148: CTP_transf_1" amino acids 9 to 261 (253 residues), 184.2 bits, see alignment E=2.3e-58

Best Hits

KEGG orthology group: K00981, phosphatidate cytidylyltransferase [EC: 2.7.7.41] (inferred from 100% identity to dvm:DvMF_2917)

Predicted SEED Role

"Phosphatidate cytidylyltransferase (EC 2.7.7.41)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 2.7.7.41)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.41

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DS99 at UniProt or InterPro

Protein Sequence (268 amino acids)

>DvMF_2917 phosphatidate cytidylyltransferase (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MTPASPHFQRVVTGTALAALLTVGLAMGGWVLLIMVVAVASLALLEFYTMFWPGNARLPL
KASGMALGAAVLAAGHMDRPWMVLGCVAAAFLVGAVGFLLTWGNGEDDCRFTEGQVLASG
ILYVPVLLLPALHFNRWEQLVVVLAAVISDTGAYFIGTWFGKARIWPRVSPKKSWAGSLG
GLALCVLAITGVGMAAGTAPWWAFALLGGLLNVASQLGDFFESALKRTLGVKDSGTLLPG
HGGLLDRIDSLLFVVPAYAALDSVFPFF