Protein Info for DvMF_2915 in Desulfovibrio vulgaris Miyazaki F

Annotation: 1-deoxy-D-xylulose 5-phosphate reductoisomerase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00243: 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  • amino acids 20 to 389 (370 residues), 434.6 bits, E=1.7e-134
• PF02670: DXP_reductoisom
  • amino acids 21 to 148 (128 residues), 139.2 bits, E=2e-44
• PF08436: DXP_redisom_C
  • amino acids 162 to 253 (92 residues), 124.3 bits, E=2.8e-40
• PF13288: DXPR_C
  • amino acids 285 to 390 (106 residues), 111.5 bits, E=4.4e-36

Best Hits

Swiss-Prot: 74% identical to DXR_DESVV: 1-deoxy-D-xylulose 5-phosphate reductoisomerase (dxr) from Desulfovibrio vulgaris subsp. vulgaris (strain DP4)

KEGG orthology group: K00099, 1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC: 1.1.1.267] (inferred from 100% identity to dvm:DvMF_2915)

Predicted SEED Role

"1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC 1.1.1.267)" in subsystem Isoprenoid Biosynthesis or polyprenyl synthesis (EC 1.1.1.267)

MetaCyc Pathways

• methylerythritol phosphate pathway II (8/9 steps found)
• superpathway of geranylgeranyl diphosphate biosynthesis II (via MEP) (9/12 steps found)
• taxadiene biosynthesis (engineered) (9/13 steps found)
• methylerythritol phosphate pathway I (6/9 steps found)
• isoprene biosynthesis I (6/10 steps found)
• superpathway of ergosterol biosynthesis II (8/26 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Terpenoid biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.267

Sequence Analysis Tools

See B8DS97 at UniProt or InterPro

Protein Sequence (457 amino acids)

>DvMF_2915 1-deoxy-D-xylulose 5-phosphate reductoisomerase (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MIRYISRMPDRAWEDATPRTVALLGSTGSIGTSALKVIEAHPDLFRVAALAGARNVRLLA
EQAARHRPAHLGVLDEAGAKELRALLPARYAPEIHVGPEGYATLAALPDASTVLSAQVGA
AGLRATVAAARAGKVICLANKESLVLAGALIRQICAETGAVVLPVDSEHNAVFQALRVHD
TLQDGGRAPHAVRRVILTASGGPFRGRDRAFLSTVTREQALNHPNWSMGAKITIDSATLM
NKGLEVIEAYHLYGVAPESIEVVVHPQSIVHSLVEYADGSQIAHLGTPDMRIAIAYCMAW
PRCVDTGVAPLDLVRAGSLTFEAPDLSSFPCLALARRVLAREAGSPGGAALPVVLNAANE
VAVDLFLHGRIGFMDIPALIERALDAHEAGTPDTNGPDTSAPDTSGPDTNAPGAASTGTD
GTFLMHDIDHIEALDAATRRRVRHWADAAGTQGTGNA