Protein Info for DvMF_2871 in Desulfovibrio vulgaris Miyazaki F

Annotation: MotA/TolQ/ExbB proton channel (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 251 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details transmembrane" amino acids 20 to 23 (4 residues), see Phobius details amino acids 28 to 28 (1 residues), see Phobius details amino acids 34 to 55 (22 residues), see Phobius details amino acids 146 to 167 (22 residues), see Phobius details amino acids 178 to 198 (21 residues), see Phobius details PF01618: MotA_ExbB" amino acids 101 to 216 (116 residues), 81.5 bits, see alignment E=2.3e-27

Best Hits

Swiss-Prot: 38% identical to POMA_VIBAL: Chemotaxis protein PomA (pomA) from Vibrio alginolyticus

KEGG orthology group: K02556, chemotaxis protein MotA (inferred from 100% identity to dvm:DvMF_2871)

Predicted SEED Role

"Flagellar motor rotation protein MotA" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DRH1 at UniProt or InterPro

Protein Sequence (251 amino acids)

>DvMF_2871 MotA/TolQ/ExbB proton channel (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MDIATLFGLIVGLAMVFGAIMGGGSIWLFVDLHAFMIVVGGSLAAICINFPLNQVLQAFR
AASKTLMMREFSDADVVNSMVRIAELSRREGIMALEHVHTNDAVLKKACMLIADNAAPEL
IKDSLLIEISSLCKRHSVAQNVFKRLGLLAPSLGLTGTLIGLVQMFANLDNPKSIGPAMS
VAMICTFYGAMLSNLILTPIAGKLAARTQLEVHRLEIIFEGAKCILENNNPRLVYEKLSS
FLAPKERRYAR