Protein Info for DvMF_2815 in Desulfovibrio vulgaris Miyazaki F

Annotation: phosphoribosylaminoimidazole-succinocarboxamide synthase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00081: phosphoribosylaminoimidazolesuccinocarboxamide synthase
  • amino acids 7 to 295 (289 residues), 251.5 bits, E=5.1e-79
• PF01259: SAICAR_synt
  • amino acids 15 to 267 (253 residues), 254.6 bits, E=5.2e-80

Best Hits

Swiss-Prot: 65% identical to PUR7_DESAD: Phosphoribosylaminoimidazole-succinocarboxamide synthase (purC) from Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763)

KEGG orthology group: K01923, phosphoribosylaminoimidazole-succinocarboxamide synthase [EC: 6.3.2.6] (inferred from 100% identity to dvm:DvMF_2815)

MetaCyc: 53% identical to phosphoribosylamidoimidazole-succinocarboxamide synthetase (Saccharomyces cerevisiae)
Phosphoribosylaminoimidazolesuccinocarboxamide synthase. [EC: 6.3.2.6]

Predicted SEED Role

"Phosphoribosylaminoimidazole-succinocarboxamide synthase (EC 6.3.2.6)" in subsystem De Novo Purine Biosynthesis (EC 6.3.2.6)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (42/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (23/26 steps found)
• inosine-5'-phosphate biosynthesis II (5/5 steps found)
• inosine-5'-phosphate biosynthesis I (5/6 steps found)
• inosine-5'-phosphate biosynthesis III (4/6 steps found)

KEGG Metabolic Maps

• Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.6

Sequence Analysis Tools

See B8DRB6 at UniProt or InterPro

Protein Sequence (298 amino acids)

>DvMF_2815 phosphoribosylaminoimidazole-succinocarboxamide synthase (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MQVVTQTDIKEYPLLSRGKVRDIYEIDAQTLLIVTTDRMSAFDVIMGEPIPYKGVILNSI
TLFWMNRFAGLVKNHLIEHDVNRFPAPLAPYRDMLEGRAVIVRKAKPLPVECIVRGHITG
SGWKDYKATGAVCGHKLPAGLPESAKLETPLFTPSTKAELGAHDENISIGQAAKLLGDDL
AARVQELSIAIFSQGREYAEGRGIIIADTKFEFGLVDGEVILIDEVLTPDSSRFWPAEGY
APGKGQPSFDKQYLRDWLASQPWDKTPPPPALPEHVIAETGKKYREAYEILTGSKLAV