Protein Info for DvMF_2790 in Desulfovibrio vulgaris Miyazaki F

Annotation: Tetratricopeptide TPR_2 repeat protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 305 PF13424: TPR_12" amino acids 189 to 246 (58 residues), 37.4 bits, see alignment E=9.7e-13 PF13374: TPR_10" amino acids 193 to 212 (20 residues), 14.8 bits, see alignment (E = 9.4e-06) amino acids 222 to 245 (24 residues), 16.2 bits, see alignment (E = 3.4e-06) PF14559: TPR_19" amino acids 194 to 249 (56 residues), 38.7 bits, see alignment E=4.2e-13 PF13181: TPR_8" amino acids 218 to 248 (31 residues), 20.2 bits, see alignment (E = 2e-07) PF07719: TPR_2" amino acids 219 to 249 (31 residues), 30 bits, see alignment (E = 1.4e-10) PF13176: TPR_7" amino acids 220 to 248 (29 residues), 20.4 bits, see alignment (E = 1.6e-07)

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvm:DvMF_2790)

Predicted SEED Role

"TPR domain protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DR91 at UniProt or InterPro

Protein Sequence (305 amino acids)

>DvMF_2790 Tetratricopeptide TPR_2 repeat protein (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MVPQVLGVYVSVRTERTGMGSTSRDVSQKIYWLAACQAAGPDPAGQTERLDGSGRAGKTE
LAEGGRYILQPLTEAHLPSGLVKELPEADFIEHFLPDADCYEKFIRPAAEALAAYIDDLP
ADAPFSVEQFSPLALPFDQQRVLEGLLAVLRGRPGLVPRAHDVPDLRAMLEGMCRLRMVP
DFQNRVAGVAIGLRKRGDYAAAEYYYERALAVSGQEDRILFNLARVYYETGRPQQAADCL
RRALAANPGLAVAEQFLRFVLTGMRSGAPEGAEAPGEADPADVGNDDPASAVLKPDTPAP
DTPGA