Protein Info for DvMF_2751 in Desulfovibrio vulgaris Miyazaki F

Annotation: inner-membrane translocator (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 301 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 42 to 63 (22 residues), see Phobius details amino acids 69 to 89 (21 residues), see Phobius details amino acids 101 to 124 (24 residues), see Phobius details amino acids 147 to 167 (21 residues), see Phobius details amino acids 197 to 220 (24 residues), see Phobius details amino acids 227 to 245 (19 residues), see Phobius details amino acids 250 to 270 (21 residues), see Phobius details amino acids 275 to 294 (20 residues), see Phobius details PF02653: BPD_transp_2" amino acids 8 to 285 (278 residues), 155.7 bits, see alignment E=6.8e-50

Best Hits

KEGG orthology group: K01997, branched-chain amino acid transport system permease protein (inferred from 100% identity to dvm:DvMF_2751)

Predicted SEED Role

"High-affinity branched-chain amino acid transport system permease protein LivH (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DJ29 at UniProt or InterPro

Protein Sequence (301 amino acids)

>DvMF_2751 inner-membrane translocator (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MEEFFQQLTNGLAVGGIYALIALGYTMVYGVLKLINFAHGDLFTIGAYLGFTLFTAFGLS
GFVSGPGGVLLVLVMVMGLVALIGFLLERVAYRPLRSSSRLSAVVSALGASIFFQNAVML
IYGAKFQVYPNDIRPSYVLSIMGIDVPLVRIMMIAASLGLMLALYWFTQRTRIGAAIRAT
AIDQGAAKLMGIDVNRVISLVFMIGPALGGVAGVMVGLYYGQVDFTMGWVYGLKAFTAAI
LGGIGNIPGAMVGGLLLGVIEALGAAYISIAWKDAIAFLVLILILIIRPTGLLGERVADK
I