Protein Info for DvMF_2697 in Desulfovibrio vulgaris Miyazaki F

Annotation: acyltransferase 3 (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 363 transmembrane" amino acids 28 to 52 (25 residues), see Phobius details amino acids 61 to 78 (18 residues), see Phobius details amino acids 98 to 118 (21 residues), see Phobius details amino acids 127 to 141 (15 residues), see Phobius details amino acids 148 to 164 (17 residues), see Phobius details amino acids 176 to 195 (20 residues), see Phobius details amino acids 215 to 234 (20 residues), see Phobius details amino acids 243 to 260 (18 residues), see Phobius details amino acids 266 to 283 (18 residues), see Phobius details amino acids 295 to 313 (19 residues), see Phobius details amino acids 329 to 349 (21 residues), see Phobius details PF01757: Acyl_transf_3" amino acids 22 to 346 (325 residues), 97 bits, see alignment E=5.9e-32

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvm:DvMF_2697)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DIX5 at UniProt or InterPro

Protein Sequence (363 amino acids)

>DvMF_2697 acyltransferase 3 (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MLNWWVSALWSTVVSPSRDTGYLTGLRAYAAFAVVAIHTGLGGIGGLGAFFSNLVNHGKH
GVPLFFVLSGYTIALSIYKSDKFSYALYWRRRCSRILPLYFGLIVFLFLIGYEGSYWAKE
LDAPNDFFSLVAHVFFLNVYLSQYSNNIIGVEWSIPVEFFYYTIIPSMAFLAKKPFGWVL
LCVFAYVFSRFGLILPSPFADGSEYRYLAWGWQPFRYVWCFVLGVCLASLCTHLDVVKRA
FEHSILTVLILIVFVVYVYHVHEGSLVFYTLISCGLIITSGRCNKVACFLFENNVALYLG
NISFSLYLLHYPVMKMMYSSAYGNSLTRFAVYIVALFAVATLSYVFIEYPFFHRKTKQRA
LGL