Protein Info for DvMF_2689 in Desulfovibrio vulgaris Miyazaki F

Annotation: molybdopterin oxidoreductase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 691 transmembrane" amino acids 7 to 26 (20 residues), see Phobius details PF00384: Molybdopterin" amino acids 106 to 457 (352 residues), 85.1 bits, see alignment E=5.2e-28 PF01568: Molydop_binding" amino acids 586 to 674 (89 residues), 42.9 bits, see alignment E=4.4e-15

Best Hits

Swiss-Prot: 74% identical to QRCB_DESVH: Menaquinone reductase, molybdopterin-binding-like subunit (qrcB) from Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / DSM 644 / NCIMB 8303)

KEGG orthology group: None (inferred from 100% identity to dvm:DvMF_2689)

MetaCyc: 74% identical to cytochrome c3:menaquinone reductase subunit B (Desulfovibrio vulgaris)
RXN-23228

Predicted SEED Role

"polysulfide reductase, subunit A" in subsystem Anaerobic respiratory reductases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DIW7 at UniProt or InterPro

Protein Sequence (691 amino acids)

>DvMF_2689 molybdopterin oxidoreductase (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MALDRRGFLKFIGGATAGILATPVVWKSLDDVSIWTQNWSWIPRNIDGANSYVPTVSKLC
PSAVGVKVRLVDGRPVRVLTNNDHPLGGGLSSIAAAEVQLLYSPSRMKRPLKRTADGAYV
GITWEEAEAMLVEGLKKAKGGDKLAVISGDETGTINELFTALAAEMGSKSCFLMPGEAQS
AAKAWELMGGEGQVGYDIEKSDYVLAIGANVLETWGPVIRNRHAFRVGRPHGEAPAVRFA
YAGPVQNNTAATADTWLAIRPGTEAVLALGLANLLIKAGATSPAADFADFKALAAKFPPE
QVAAQTGVDAKRLAAVAQELAKAKRPLVIAGSEIGQGGGAAPVLAGLALNALLGSMNREG
GIRALPYARKVVPAAMDRKALLQNDLVAWLGKVASGKSAAPQAVVFYEANPVYALPQADA
MKATLAKVPFKVAFTSFLDETAMACDLVLPVPMGLERFDDVDTPYGCGQVVYALAVPALA
PLVDARPAGDVVIGVAKKLGADLGVAAFADALKAKAEARGASFTEPSATNAHVSNAVLPV
NGIALRADVLSKAIDVKAPAFPVALAPVAKLNVGTSKTATPPFNTKTVRRWEIQGKELYV
MMNGATAAKLGLRMHDRIELSNPAGKFTARVNLFEGVINDTVAVPAGHGHTAFDEFSKGK
GENVMRLLAAGAEPGTGLSVWTSAGVNIAKA