Protein Info for DvMF_2681 in Desulfovibrio vulgaris Miyazaki F

Annotation: ribonuclease BN (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 561 transmembrane" amino acids 60 to 81 (22 residues), see Phobius details amino acids 122 to 141 (20 residues), see Phobius details amino acids 161 to 183 (23 residues), see Phobius details amino acids 202 to 224 (23 residues), see Phobius details amino acids 236 to 258 (23 residues), see Phobius details amino acids 278 to 299 (22 residues), see Phobius details amino acids 322 to 340 (19 residues), see Phobius details TIGR00765: YihY family inner membrane protein" amino acids 50 to 300 (251 residues), 158.6 bits, see alignment E=1.4e-50 PF03631: Virul_fac_BrkB" amino acids 52 to 301 (250 residues), 188.6 bits, see alignment E=8.9e-60

Best Hits

KEGG orthology group: K07058, membrane protein (inferred from 100% identity to dvm:DvMF_2681)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DIV9 at UniProt or InterPro

Protein Sequence (561 amino acids)

>DvMF_2681 ribonuclease BN (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MHGPTLRDRARRVRRYVTRDVWLERAETGPPARRGLVWLVRRAFLAALGFVDDQCLLRAS
ALTMTFVLSMVPFLAVVFSITKGLGVHNAEATQMLLLRLAAGNPDTVARILEYVERTSAG
RMGAVSAAFLLVTAGMLMANIERSFNAIWKVRQGRSAWRKFTDFFSVMLVCPLLMGTAFT
LGASLRSGKVLGRLLEVAPVGAVYLLLLKLVPLFMVFVVLLFLYSYIPNTRVRPRAAMAG
ALLAAMAWQGAEYAYMVWQARFASYGLIYGSFAQVPLFLMWLYVSWAVVLFGVEVCHAVQ
NAPTFEKHLRAGRVSRLERDRLAVLAMLLLTRAFVRGTGAVPGHRMAALLDAPDHVLDDV
LDRLAREGMVVRACDDAPAWVLGTPPDGLRIADVLLALAGRTHGEGEERVATSFEFINDT
LTRLAGDMAASPANATLRAYHDTTLPDWFDAAPASAHQTPENAPDDVREDEPDDEPDDEP
DDAWPGAKPGAWPGAWPAAGNGARDGAGKGETQQPTLRQLLHGAASDGTSAPDDVPAPPS
PPLPDDTGGTGKGGPPGSGRV